KEGG   Homo sapiens (human): 5971Help
Entry
5971              CDS       T01001                                 

Gene name
RELB, I-REL, IMD53, IREL, REL-B
Definition
(RefSeq) RELB proto-oncogene, NF-kB subunit
  KO
K09253  transcription factor RelB
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa05166  HTLV-I infection
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    5971 (RELB)
   04064 NF-kappa B signaling pathway
    5971 (RELB)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    5971 (RELB)
  Development
   04380 Osteoclast differentiation
    5971 (RELB)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    5971 (RELB)
   05169 Epstein-Barr virus infection
    5971 (RELB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5971 (RELB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RelB_transactiv RHD_DNA_bind RelB_leu_zip RHD_dimer
Motif
Other DBs
NCBI-GeneID: 5971
NCBI-ProteinID: NP_006500
OMIM: 604758
HGNC: 9956
Ensembl: ENSG00000104856
Vega: OTTHUMG00000162116
Pharos: Q01201(Tbio)
UniProt: Q01201
Position
19q13.32
AA seq 579 aa AA seqDB search
MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEY
IKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPG
PGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEV
TACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIE
RKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNT
SELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIV
FKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLG
ELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPG
GPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQ
APGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggtctgggccagcctctgggccgtccgtccccactggccgggccatgccgagt
cgccgcgtcgccagaccgccggctgcgccggagctgggggccttagggtcccccgacctc
tcctcactctcgctcgccgtttccaggagcacagatgaattggagatcatcgacgagtac
atcaaggagaacggcttcggcctggacgggggacagccgggcccgggcgaggggctgcca
cgcctggtgtctcgcggggctgcgtccctgagcacggtcaccctgggccctgtggcgccc
ccagccacgccgccgccttggggctgccccctgggccgactagtgtccccagcgccgggc
ccgggcccgcagccgcacctggtcatcacggagcagcccaagcagcgcggcatgcgcttc
cgctacgagtgcgagggccgctcggccggcagcatccttggggagagcagcaccgaggcc
agcaagacgctgcccgccatcgagctccgggattgtggagggctgcgggaggtggaggtg
actgcctgcctggtgtggaaggactggcctcaccgagtccacccccacagcctcgtgggg
aaagactgcaccgacggcatctgcagggtgcggctccggcctcacgtcagcccccggcac
agttttaacaacctgggcatccagtgtgtgaggaagaaggagattgaggctgccattgag
cggaagattcaactgggcattgacccctacaacgctgggtccctgaagaaccatcaggaa
gtagacatgaatgtggtgaggatctgcttccaggcctcatatcgggaccagcagggacag
atgcgccggatggatcctgtgctttccgagcccgtctatgacaagaaatccacaaacaca
tcagagctgcggatttgccgaattaacaaggaaagcgggccgtgcaccggtggcgaggag
ctctacttgctctgcgacaaggtgcagaaagaggacatatcagtggtgttcagcagggcc
tcctgggaaggtcgggctgacttctcccaggccgacgtgcaccgccagattgccattgtg
ttcaagacgccgccctacgaggacctggagattgtcgagcccgtgacagtcaacgtcttc
ctgcagcggctcaccgatggggtctgcagcgagccattgcctttcacgtacctgcctcgc
gaccatgacagctacggcgtggacaagaagcggaaacgggggatgcccgacgtccttggg
gagctgaacagctctgacccccatggcatcgagagcaaacggcggaagaaaaagccggcc
atcctggaccacttcctgcccaaccacggctcaggcccgttcctcccgccgtcagccctg
ctgccagaccctgacttcttctctggcaccgtgtccctgcccggcctggagccccctggc
gggcctgacctcctggacgatggctttgcctacgaccctacggcccccacactcttcacc
atgctggacctgctgcccccggcaccgccacacgctagcgctgttgtgtgcagcggaggt
gccggggccgtggttggggagacccccggccctgaaccactgacactggactcgtaccag
gccccgggccccggggatggaggcaccgccagccttgtgggcagcaacatgttccccaat
cattaccgcgaggcggcctttgggggcggcctcctatccccggggcctgaagccacgtag

DBGET integrated database retrieval system