KEGG   Homo sapiens (human): 5972Help
Entry
5972              CDS       T01001                                 

Gene name
REN, HNFJ2
Definition
(RefSeq) renin
  KO
K01380  renin [EC:3.4.23.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04924  Renin secretion
Disease
H00541  Autosomal dominant tubulointerstitial kidney disease
H00575  Renal tubular dysgenesis
H02011  Familial juvenile hyperuricemic nephropathy
Drug target
Aliskiren (DG00352): D03208 D06412
Ditekiren: D03741
Enalkiren: D03738
Remikiren: D09038
Terlakiren: D03743
Zankiren hydrochloride: D03745
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5972 (REN)
   04614 Renin-angiotensin system
    5972 (REN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5972 (REN)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     5972 (REN)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   5972 (REN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N TAXi_C A1_Propeptide Asp_protease_2 Peptidase_C71
Motif
Other DBs
NCBI-GeneID: 5972
NCBI-ProteinID: NP_000528
OMIM: 179820
HGNC: 9958
Ensembl: ENSG00000143839
Vega: OTTHUMG00000036059
Pharos: P00797(Tclin)
UniProt: P00797
Structure
PDB: 

Position
1q32.1
AA seq 406 aa AA seqDB search
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggatggatggagaaggatgcctcgctggggactgctgctgctgctctggggctcctgt
acctttggtctcccgacagacaccaccacctttaaacggatcttcctcaagagaatgccc
tcaatccgagaaagcctgaaggaacgaggtgtggacatggccaggcttggtcccgagtgg
agccaacccatgaagaggctgacacttggcaacaccacctcctccgtgatcctcaccaac
tacatggacacccagtactatggcgagattggcatcggcaccccaccccagaccttcaaa
gtcgtctttgacactggttcgtccaatgtttgggtgccctcctccaagtgcagccgtctc
tacactgcctgtgtgtatcacaagctcttcgatgcttcggattcctccagctacaagcac
aatggaacagaactcaccctccgctattcaacagggacagtcagtggctttctcagccag
gacatcatcaccgtgggtggaatcacggtgacacagatgtttggagaggtcacggagatg
cccgccttacccttcatgctggccgagtttgatggggttgtgggcatgggcttcattgaa
caggccattggcagggtcacccctatcttcgacaacatcatctcccaaggggtgctaaaa
gaggacgtcttctctttctactacaacagagattccgagaattcccaatcgctgggagga
cagattgtgctgggaggcagcgacccccagcattacgaagggaatttccactatatcaac
ctcatcaagactggtgtctggcagattcaaatgaagggggtgtctgtggggtcatccacc
ttgctctgtgaagacggctgcctggcattggtagacaccggtgcatcctacatctcaggt
tctaccagctccatagagaagctcatggaggccttgggagccaagaagaggctgtttgat
tatgtcgtgaagtgtaacgagggccctacactccccgacatctctttccacctgggaggc
aaagaatacacgctcaccagcgcggactatgtatttcaggaatcctacagtagtaaaaag
ctgtgcacactggccatccacgccatggatatcccgccacccactggacccacctgggcc
ctgggggccaccttcatccgaaagttctacacagagtttgatcggcgtaacaaccgcatt
ggcttcgccttggcccgctga

DBGET integrated database retrieval system