KEGG   Homo sapiens (human): 5976Help
Entry
5976              CDS       T01001                                 

Gene name
UPF1, HUPF1, NORF1, RENT1, pNORF1, smg-2
Definition
(RefSeq) UPF1 RNA helicase and ATPase
  KO
K14326  regulator of nonsense transcripts 1 [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
Module
hsa_M00430  Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    5976 (UPF1)
   03015 mRNA surveillance pathway
    5976 (UPF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5976 (UPF1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     5976 (UPF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     5976 (UPF1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5976 (UPF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF1_Zn_bind AAA_12 AAA_11 DUF5599 AAA_30 AAA_19 ResIII DUF2075 Helicase_RecD ATPase SRP54 UvrD-helicase UvrD_C_2 DEAD AAA_10
Motif
Other DBs
NCBI-GeneID: 5976
NCBI-ProteinID: NP_001284478
OMIM: 601430
HGNC: 9962
Ensembl: ENSG00000005007
Vega: OTTHUMG00000183025
Pharos: Q92900(Tbio)
UniProt: Q92900 A0A024R7L8 B3KY55
Structure
PDB: 

Position
19p13.11
AA seq 1129 aa AA seqDB search
MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAG
GPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPI
HACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETV
LECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLS
WLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAY
QYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVII
WLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNF
QVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLP
DLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQ
LTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSS
ADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVP
VVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALS
AFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTE
AANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAF
QGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLL
NYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDR
SSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRG
TPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQ
PGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggaggcgtacgggcccagctcgcagactctcactttcctggacacggaggag
gccgagctgcttggcgccgacacacagggctccgagttcgagttcaccgactttactctt
cctagccagacgcagacgccccccggcggccccggcggcccgggcggtggcggcgcggga
ggcccgggcggcgcgggcgcgggcgctgcggcgggacagctcgacgcgcaggttgggccc
gaaggcatcctgcagaacggggctgtggacgacagtgtagccaagaccagccagttgttg
gctgagttgaacttcgaggaagatgaagaagacacctattacacgaaggacctccccata
cacgcctgcagttactgtggaatacacgatcctgcctgcgtggtttactgtaataccagc
aagaagtggttctgcaacggacgtggaaatacttctggcagccacattgtaaatcacctt
gtgagggcaaaatgcaaagaggtgaccctgcacaaggacgggcccctgggggagacagtc
ctggagtgctacaactgcggctgtcgcaacgtcttcctcctcggcttcatcccggccaaa
gctgactcagtggtggtgctgctgtgcaggcagccctgtgccagccagagcagcctcaag
gacatcaactgggacagctcgcagtggcagccgctgatccaggaccgctgcttcctgtcc
tggctggtcaagatcccctccgagcaggagcagctgcgggcacgccagatcacggcacag
cagatcaacaagctggaggagctgtggaaggaaaacccttctgccacgctggaggacctg
gagaagccgggggtggacgaggagccgcagcatgtcctcctgcggtacgaggacgcctac
cagtaccagaacatattcgggcccctggtcaagctggaggccgactacgacaagaagctg
aaggagtcccagactcaagataacatcactgtcaggtgggacctgggccttaacaagaag
agaatcgcctacttcactttgcccaagactgactctggtaatgaggatttagtcataatt
tggttaagagacatgcggctcatgcagggggatgagatatgcctgcggtacaaaggggac
cttgcgcccctgtggaaagggatcggccacgtcatcaaggtccctgataattatggcgat
gagatcgccattgagctgcggagcagcgtgggtgcacctgtggaggtgactcacaacttc
caggtggattttgtgtggaagtcgacctcctttgacaggatgcagagcgcattgaaaacg
tttgccgtggatgagacctcggtgtctggctacatctaccacaagctgttgggccacgag
gtggaggacgtaatcatcaagtgccagctgcccaagcgcttcacggcgcagggcctcccc
gacctcaaccactcccaggtttatgccgtgaagactgtgctgcaaagaccactgagcctg
atccagggcccgccaggcacggggaagacggtgacgtcggccaccatcgtctaccacctg
gcccggcaaggcaacgggccggtgctggtgtgtgctccgagcaacatcgccgtggaccag
ctaacggagaagatccaccagacggggctaaaggtcgtgcgcctctgcgccaagagccgt
gaggccatcgactccccggtgtcttttctggccctgcacaaccagatcaggaacatggac
agcatgcctgagctgcagaagctgcagcagctgaaagacgagactggggagctgtcgtct
gccgacgagaagcggtaccgggccttgaagcgcaccgcagagagagagctgctgatgaac
gcagatgtcatctgctgcacatgtgtgggcgccggtgacccgaggctggccaagatgcag
ttccgctccattttaatcgacgaaagcacccaggccaccgagccggagtgcatggttccc
gtggtcctcggggccaagcagctgatccttgtaggcgaccactgccagctgggcccagtg
gtgatgtgcaagaaggcggccaaggccgggctgtcacagtcgctcttcgagcgcctggtg
gtgctgggcatccggcccatccgcctgcaggtccagtaccggatgcaccctgcactcagc
gccttcccatccaacatcttctacgagggctccctccagaatggtgtcactgcagcggat
cgtgtgaagaagggatttgacttccagtggccccaacccgataaaccgatgttcttctac
gtgacccagggccaagaggagattgccagctcgggcacctcctacctgaacaggaccgag
gctgcgaacgtggagaagatcaccacgaagttgctgaaggcaggcgccaagccggaccag
attggcatcatcacgccctacgagggccagcgctcctacctggtgcagtacatgcagttc
agcggctccctgcacaccaagctctaccaggaggtggagatcgccagtgtggacgccttt
cagggacgcgagaaggacttcatcatcctgtcctgtgtgcgggccaacgagcaccaaggc
attggctttttaaatgaccccaggcgtctgaacgtggccctgaccagagcaaggtatggc
gtcatcattgtgggcaacccgaaggcactatcaaagcagccgctctggaaccacctgctg
aactactataaggagcagaaggtgctggtggaggggccgctcaacaacctgcgtgagagc
ctcatgcagttcagcaagccacggaagctggtcaacactatcaacccgggagcccgcttc
atgaccacagccatgtatgatgcccgggaggccatcatcccaggctccgtctatgatcgg
agcagccagggccggccttccagcatgtacttccagacccatgaccagattggcatgatc
agtgccggccctagccacgtggctgccatgaacattcccatccccttcaacctggtcatg
ccacccatgccaccgcctggctattttggacaagccaacgggcctgctgcagggcgaggc
accccgaaaggcaagactggtcgtgggggacgccagaagaaccgctttgggcttcctgga
cccagccagactaacctccccaacagccaagccagccaggatgtggcgtcacagcccttc
tctcagggcgccctgacgcagggctacatctccatgagccagccttcccagatgagccag
cccggcctctcccagccggagctgtcccaggacagttaccttggtgacgagtttaaatca
caaatcgacgtggcgctctcacaggactccacgtaccagggagagcgggcttaccagcat
ggcggggtgacggggctgtcccagtattaa

DBGET integrated database retrieval system