KEGG   Homo sapiens (human): 5976
Entry
5976              CDS       T01001                                 

Gene name
UPF1, HUPF1, NORF1, RENT1, pNORF1, smg-2
Definition
(RefSeq) UPF1 RNA helicase and ATPase
  KO
K14326  regulator of nonsense transcripts 1 [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    5976 (UPF1)
   03015 mRNA surveillance pathway
    5976 (UPF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5976 (UPF1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     5976 (UPF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     5976 (UPF1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     5976 (UPF1)
SSDB
Motif
Pfam: UPF1_Zn_bind AAA_12 AAA_11 DUF5599 AAA_30 AAA_19 ResIII DUF2075 Helicase_RecD ATPase SRP54 UvrD-helicase UvrD_C_2 DEAD AAA_10
Other DBs
NCBI-GeneID: 5976
NCBI-ProteinID: NP_001284478
OMIM: 601430
HGNC: 9962
Ensembl: ENSG00000005007
Vega: OTTHUMG00000183025
Pharos: Q92900(Tbio)
UniProt: Q92900 A0A024R7L8 B3KY55
Structure
PDB: 

Position
19p13.11
AA seq 1129 aa
MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAG
GPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTYYTKDLPI
HACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETV
LECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLS
WLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAY
QYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTDSGNEDLVII
WLRDMRLMQGDEICLRYKGDLAPLWKGIGHVIKVPDNYGDEIAIELRSSVGAPVEVTHNF
QVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGHEVEDVIIKCQLPKRFTAQGLP
DLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHLARQGNGPVLVCAPSNIAVDQ
LTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMDSMPELQKLQQLKDETGELSS
ADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQFRSILIDESTQATEPECMVP
VVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLVVLGIRPIRLQVQYRMHPALS
AFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTSYLNRTE
AANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAF
QGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLL
NYYKEQKVLVEGPLNNLRESLMQFSKPRKLVNTINPGARFMTTAMYDAREAIIPGSVYDR
SSQGRPSSMYFQTHDQIGMISAGPSHVAAMNIPIPFNLVMPPMPPPGYFGQANGPAAGRG
TPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQGYISMSQPSQMSQ
PGLSQPELSQDSYLGDEFKSQIDVALSQDSTYQGERAYQHGGVTGLSQY
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgagcgtggaggcgtacgggcccagctcgcagactctcactttcctggacacggaggag
gccgagctgcttggcgccgacacacagggctccgagttcgagttcaccgactttactctt
cctagccagacgcagacgccccccggcggccccggcggcccgggcggtggcggcgcggga
ggcccgggcggcgcgggcgcgggcgctgcggcgggacagctcgacgcgcaggttgggccc
gaaggcatcctgcagaacggggctgtggacgacagtgtagccaagaccagccagttgttg
gctgagttgaacttcgaggaagatgaagaagacacctattacacgaaggacctccccata
cacgcctgcagttactgtggaatacacgatcctgcctgcgtggtttactgtaataccagc
aagaagtggttctgcaacggacgtggaaatacttctggcagccacattgtaaatcacctt
gtgagggcaaaatgcaaagaggtgaccctgcacaaggacgggcccctgggggagacagtc
ctggagtgctacaactgcggctgtcgcaacgtcttcctcctcggcttcatcccggccaaa
gctgactcagtggtggtgctgctgtgcaggcagccctgtgccagccagagcagcctcaag
gacatcaactgggacagctcgcagtggcagccgctgatccaggaccgctgcttcctgtcc
tggctggtcaagatcccctccgagcaggagcagctgcgggcacgccagatcacggcacag
cagatcaacaagctggaggagctgtggaaggaaaacccttctgccacgctggaggacctg
gagaagccgggggtggacgaggagccgcagcatgtcctcctgcggtacgaggacgcctac
cagtaccagaacatattcgggcccctggtcaagctggaggccgactacgacaagaagctg
aaggagtcccagactcaagataacatcactgtcaggtgggacctgggccttaacaagaag
agaatcgcctacttcactttgcccaagactgactctggtaatgaggatttagtcataatt
tggttaagagacatgcggctcatgcagggggatgagatatgcctgcggtacaaaggggac
cttgcgcccctgtggaaagggatcggccacgtcatcaaggtccctgataattatggcgat
gagatcgccattgagctgcggagcagcgtgggtgcacctgtggaggtgactcacaacttc
caggtggattttgtgtggaagtcgacctcctttgacaggatgcagagcgcattgaaaacg
tttgccgtggatgagacctcggtgtctggctacatctaccacaagctgttgggccacgag
gtggaggacgtaatcatcaagtgccagctgcccaagcgcttcacggcgcagggcctcccc
gacctcaaccactcccaggtttatgccgtgaagactgtgctgcaaagaccactgagcctg
atccagggcccgccaggcacggggaagacggtgacgtcggccaccatcgtctaccacctg
gcccggcaaggcaacgggccggtgctggtgtgtgctccgagcaacatcgccgtggaccag
ctaacggagaagatccaccagacggggctaaaggtcgtgcgcctctgcgccaagagccgt
gaggccatcgactccccggtgtcttttctggccctgcacaaccagatcaggaacatggac
agcatgcctgagctgcagaagctgcagcagctgaaagacgagactggggagctgtcgtct
gccgacgagaagcggtaccgggccttgaagcgcaccgcagagagagagctgctgatgaac
gcagatgtcatctgctgcacatgtgtgggcgccggtgacccgaggctggccaagatgcag
ttccgctccattttaatcgacgaaagcacccaggccaccgagccggagtgcatggttccc
gtggtcctcggggccaagcagctgatccttgtaggcgaccactgccagctgggcccagtg
gtgatgtgcaagaaggcggccaaggccgggctgtcacagtcgctcttcgagcgcctggtg
gtgctgggcatccggcccatccgcctgcaggtccagtaccggatgcaccctgcactcagc
gccttcccatccaacatcttctacgagggctccctccagaatggtgtcactgcagcggat
cgtgtgaagaagggatttgacttccagtggccccaacccgataaaccgatgttcttctac
gtgacccagggccaagaggagattgccagctcgggcacctcctacctgaacaggaccgag
gctgcgaacgtggagaagatcaccacgaagttgctgaaggcaggcgccaagccggaccag
attggcatcatcacgccctacgagggccagcgctcctacctggtgcagtacatgcagttc
agcggctccctgcacaccaagctctaccaggaggtggagatcgccagtgtggacgccttt
cagggacgcgagaaggacttcatcatcctgtcctgtgtgcgggccaacgagcaccaaggc
attggctttttaaatgaccccaggcgtctgaacgtggccctgaccagagcaaggtatggc
gtcatcattgtgggcaacccgaaggcactatcaaagcagccgctctggaaccacctgctg
aactactataaggagcagaaggtgctggtggaggggccgctcaacaacctgcgtgagagc
ctcatgcagttcagcaagccacggaagctggtcaacactatcaacccgggagcccgcttc
atgaccacagccatgtatgatgcccgggaggccatcatcccaggctccgtctatgatcgg
agcagccagggccggccttccagcatgtacttccagacccatgaccagattggcatgatc
agtgccggccctagccacgtggctgccatgaacattcccatccccttcaacctggtcatg
ccacccatgccaccgcctggctattttggacaagccaacgggcctgctgcagggcgaggc
accccgaaaggcaagactggtcgtgggggacgccagaagaaccgctttgggcttcctgga
cccagccagactaacctccccaacagccaagccagccaggatgtggcgtcacagcccttc
tctcagggcgccctgacgcagggctacatctccatgagccagccttcccagatgagccag
cccggcctctcccagccggagctgtcccaggacagttaccttggtgacgagtttaaatca
caaatcgacgtggcgctctcacaggactccacgtaccagggagagcgggcttaccagcat
ggcggggtgacggggctgtcccagtattaa

DBGET integrated database retrieval system