KEGG   Homo sapiens (human): 5978Help
Entry
5978              CDS       T01001                                 

Gene name
REST, GINGF5, HGF5, NRSF, WT6, XBR
Definition
(RefSeq) RE1 silencing transcription factor
  KO
K09222  RE1-silencing transcription factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    5978 (REST)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    5978 (REST)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5978 (REST)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    5978 (REST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-H2C2_5 zf-C2H2 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 5978
NCBI-ProteinID: NP_001180437
OMIM: 600571
HGNC: 9966
Ensembl: ENSG00000084093
Vega: OTTHUMG00000128770
Pharos: Q13127(Tbio)
UniProt: Q13127
Position
4q12
AA seq 1097 aa AA seqDB search
MATQVMGQSSGGGGLFTSSGNIGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNG
SCCDYLVGEERQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVE
PQPVFEASGAPDIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRV
HSAKKFFVEESAEKQAKARESGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTR
AGDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCGKCNYFSDRKNNYVQHVRTHTG
ERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRHARQVHNGPKP
LNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTM
DVSKVKLKKTKKREADLPDNITNEKTEIEQTKIKGDVAGKKNEKSVKAEKRDVSKEKKPS
NNVSVIQVTTRTRKSVTEVKEMDVHTGSNSEKFSKTKKSKRKLEVDSHSLHGPVNDEESS
TKKKKKVESKSKNNSQEVPKGDSKVEENKKQNTCMKKSTKKKTLKNKSSKKSSKPPQKEP
VEKGSAQMDPPQMGPAPTEAVQKGPVQVEPPPPMEHAQMEGAQIRPAPDEPVQMEVVQEG
PAQKELLPPVEPAQMVGAQIVLAHMELPPPMETAQTEVAQMGPAPMEPAQMEVAQVESAP
MQVVQKEPVQMELSPPMEVVQKEPVQIELSPPMEVVQKEPVKIELSPPIEVVQKEPVQME
LSPPMGVVQKEPAQREPPPPREPPLHMEPISKKPPLRKDKKEKSNMQSERARKEQVLIEV
GLVPVKDSWLLKESVSTEDLSPPSPPLPKENLREEASGDQKLLNTGEGNKEAPLQKVGAE
EADESLPGLAANINESTHISSSGQNLNTPEGETLNGKHQTDSIVCEMKMDTDQNTRENLT
GINSTVEEPVSPMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLS
DNMSEGSDDSGLHGARPVPQESSRKNAKEALAVKAAKGDFVCIFCDRSFRKGKDYSKHLN
RHLVNVYYLEEAAQGQE
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaggtaatggggcagtcttctggaggaggagggctgtttaccagcagtggc
aacattggaatggccctgcctaacgacatgtatgacttgcatgacctttccaaagctgaa
ctggccgcacctcagcttattatgctggcaaatgtggccttaactggggaagtaaatggc
agctgctgtgattacctggtcggtgaagaaagacagatggcagaactgatgccggttggg
gataacaacttttcagatagtgaagaaggagaaggacttgaagagtctgctgatataaaa
ggtgaacctcatggactggaaaacatggaactgagaagtttggaactcagcgtcgtagaa
cctcagcctgtatttgaggcatcaggtgctccagatatttacagttcaaataaagatctt
ccccctgaaacacctggagcggaggacaaaggcaagagctcgaagaccaaaccctttcgc
tgtaagccatgccaatatgaagcagaatctgaagaacagtttgtgcatcacatcagagtt
cacagtgctaagaaattttttgtggaagagagtgcagagaagcaggcaaaagccagggaa
tctggctcttccactgcagaagagggagatttctccaagggccccattcgctgtgaccgc
tgcggctacaatactaatcgatatgatcactatacagcacacctgaaacaccacaccaga
gctggggataatgagcgagtctacaagtgtatcatttgcacatacacaacagtgagcgag
tatcactggaggaaacatttaagaaaccattttccaaggaaagtatacacatgtggaaaa
tgcaactatttttcagacagaaaaaacaattatgttcagcatgttagaactcatacagga
gaacgcccatataaatgtgaactttgtccttactcaagttctcagaagactcatctaact
agacatatgcgtactcattcaggtgagaagccatttaaatgtgatcagtgcagttatgtg
gcctctaatcaacatgaagtaacccgccatgcaagacaggttcacaatgggcctaaacct
cttaattgcccacactgtgattacaaaacagcagatagaagcaacttcaaaaaacatgta
gagctacatgtgaacccacggcagttcaattgccctgtatgtgactatgcagcttccaag
aagtgtaatctacagtatcacttcaaatctaagcatcctacttgtcctaataaaacaatg
gatgtctcaaaagtgaaactaaagaaaaccaaaaaacgagaggctgacttgcctgataat
attaccaatgaaaaaacagaaatagaacaaacaaaaataaaaggggatgtggctggaaag
aaaaatgaaaagtccgtcaaagcagagaaaagagatgtctcaaaagagaaaaagccttct
aataatgtgtcagtgatccaggtgactaccagaactcgaaaatcagtaacagaggtgaaa
gagatggatgtgcatacaggaagcaattcagaaaaattcagtaaaactaagaaaagcaaa
aggaagctggaagttgacagccattctttacatggtcctgtgaatgatgaggaatcttca
acaaaaaagaaaaagaaggtagaaagcaaatccaaaaataatagtcaggaagtgccaaag
ggtgacagcaaagtggaggagaataaaaagcaaaatacttgcatgaaaaaaagtacaaag
aagaaaactctgaaaaataaatcaagtaagaaaagcagtaagcctcctcagaaggaacct
gttgagaagggatctgctcagatggaccctcctcagatggggcctgctcccacagaggcg
gttcagaaggggcccgttcaggtggagccgccacctcccatggagcatgctcagatggag
ggtgcccagatacggcctgctcctgacgagcctgttcagatggaggtggttcaggagggg
cctgctcagaaggagctgctgcctcccgtggagcctgctcagatggtgggtgcccaaatt
gtacttgctcacatggagctgcctcctcccatggagactgctcagacggaggttgcccaa
atggggcctgctcccatggaacctgctcagatggaggttgcccaggtagaatctgctccc
atgcaggtggtccagaaggagcctgttcagatggagctgtctcctcccatggaggtggtc
cagaaggagcctgttcagatagagctgtctcctcccatggaggtggtccagaaggaacct
gttaagatagagctgtctcctcccatagaggtggtccagaaggagcctgttcagatggag
ttgtctcctcccatgggggtggttcagaaggagcctgctcagagggagccacctcctccc
agagagcctccccttcacatggagccaatttccaaaaagcctcctctccgaaaagataaa
aaggaaaagtctaacatgcagagtgaaagggcacggaaggagcaagtccttattgaagtt
ggcttagtgcctgttaaagatagctggcttctaaaggaaagtgtaagcacagaggatctc
tcaccaccatcaccaccactgccaaaggaaaatttaagagaagaggcatcaggagaccaa
aaattactcaacacaggtgaaggaaataaagaagcccctcttcagaaagtaggagcagaa
gaggcagatgagagcctacctggtcttgctgctaatatcaacgaatctacccatatttca
tcctctggacaaaacttgaatacgccagagggtgaaactttaaatggtaaacatcagact
gacagtatagtttgtgaaatgaaaatggacactgatcagaacacaagagagaatctcact
ggtataaattcaacagttgaagaaccagtttcaccaatgcttcccccttcagcagtagaa
gaacgtgaagcagtgtccaaaactgcactggcatcacctcctgctacaatggcagcaaat
gagtctcaggaaattgatgaagatgaaggcatccacagccatgaaggaagtgacctaagt
gacaacatgtcagagggtagtgatgattctggattgcatggggctcggccagttccacaa
gaatctagcagaaaaaatgcaaaggaagccttggcagtcaaagcggctaagggagatttt
gtttgtatcttctgtgatcgttctttcagaaagggaaaagattacagcaaacacctcaat
cgccatttggttaatgtgtactatcttgaagaagcagctcaagggcaggagtaa

DBGET integrated database retrieval system