KEGG   Homo sapiens (human): 598Help
Entry
598               CDS       T01001                                 

Gene name
BCL2L1, BCL-XL/S, BCL2L, BCLX, Bcl-X, PPP1R52
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01524  Platinum drug resistance
hsa04014  Ras signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04115  p53 signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05145  Toxoplasmosis
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05225  Hepatocellular carcinoma
Network
N00055  BCR-ABL fusion kinase to Jak-STAT signaling pathway
N00098  Intrinsic apoptotic pathway
N00123  Amplified REL to transcription
Drug target
Navitoclax: D09935
Navitoclax dihydrochloride: D09936
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    598 (BCL2L1)
   04630 Jak-STAT signaling pathway
    598 (BCL2L1)
   04064 NF-kappa B signaling pathway
    598 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    598 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    598 (BCL2L1)
   04137 Mitophagy - animal
    598 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    598 (BCL2L1)
   04215 Apoptosis - multiple species
    598 (BCL2L1)
   04115 p53 signaling pathway
    598 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    598 (BCL2L1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    598 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    598 (BCL2L1)
   05212 Pancreatic cancer
    598 (BCL2L1)
   05225 Hepatocellular carcinoma
    598 (BCL2L1)
   05220 Chronic myeloid leukemia
    598 (BCL2L1)
   05222 Small cell lung cancer
    598 (BCL2L1)
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    598 (BCL2L1)
  09167 Infectious diseases
   05166 HTLV-I infection
    598 (BCL2L1)
   05145 Toxoplasmosis
    598 (BCL2L1)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    598 (BCL2L1)
   01524 Platinum drug resistance
    598 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    598 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    598 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    598 (BCL2L1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     598 (BCL2L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    598 (BCL2L1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   598 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 Nitrate_red_del
Motif
Other DBs
NCBI-GeneID: 598
NCBI-ProteinID: NP_001304848
OMIM: 600039
HGNC: 992
Ensembl: ENSG00000171552
Vega: OTTHUMG00000032192
Pharos: Q07817(Tchem)
UniProt: Q07817 A0A0S2Z3C5
Structure
PDB: 

Position
20q11.21
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggca
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca
gccgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system