KEGG   Homo sapiens (human): 5981Help
Entry
5981              CDS       T01001                                 

Gene name
RFC1, A1, MHCBFB, PO-GA, RECC1, RFC, RFC140
Definition
(RefSeq) replication factor C subunit 1
  KO
K10754  replication factor C subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Module
hsa_M00289  RF-C complex
hsa_M00295  BRCA1-associated genome surveillance complex (BASC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5981 (RFC1)
   03420 Nucleotide excision repair
    5981 (RFC1)
   03430 Mismatch repair
    5981 (RFC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5981 (RFC1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5981 (RFC1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5981 (RFC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    RFC (replication factor C)
     5981 (RFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT Rad17 RuvB_N AAA_5 AAA_16 AAA_22 AAA_33 AAA_14 BRCT_2 AAA_18 AAA_17 AAA_7 RNA_helicase NTPase_1 AAA_30
Motif
Other DBs
NCBI-GeneID: 5981
NCBI-ProteinID: NP_001191676
OMIM: 102579
HGNC: 9969
Ensembl: ENSG00000035928
Vega: OTTHUMG00000099363
Pharos: P35251(Tbio)
UniProt: P35251
Structure
PDB: 

Position
4p14
AA seq 1148 aa AA seqDB search
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPS
KKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKK
MVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS
KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSS
PAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIR
TMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAK
TIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIG
QQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTT
ASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMD
EVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQI
KGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGD
MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFP
SWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQD
VVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAI
KASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRK
GKGKSSKK
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atggacattcggaaattctttggagtaataccaagtggaaagaaacttgtaagtgaaaca
gtaaagaagaatgagaaaacaaagtctgatgaagaaactttaaaagcaaagaaaggaata
aaggaaatcaaggtaaatagctcccgtaaagaggatgacttcaaacaaaagcaaccaagc
aagaaaaagaggatcatctatgattcagattcagagtcagaggagacgttgcaggtaaaa
aatgccaaaaagccaccagaaaaactgccagtatcttctaaacctggtaaaatttcacgg
caggatcctgttacatacatttcagaaacagatgaagaagatgactttatgtgtaagaag
gcggcctctaaatcaaaagagaatggaagatctacaaatagtcatcttggaacatcaaac
atgaaaaagaatgaagaaaacactaagaccaagaataagcctttatcaccaataaaactt
acacccacatcagtacttgattattttggaactggaagtgtccaaagatctaataagaag
atggtggcaagcaaaagaaaagagctttcacaaaatacagatgagtctggattaaatgat
gaagccatcgccaagcaattacagcttgatgaagatgcggagctggagaggcagttgcat
gaagatgaagagtttgccagaacattagccatgttggatgaagaacccaagaccaaaaag
gctcgaaaggacacagaagcgggagaaacgttttcatctgtccaagccaatttaagtaaa
gcagaaaaacataaatatcctcataaagtaaaaacagcacaagtttcagatgaaagaaag
agctacagtcctaggaagcaaagtaaatatgaaagttcaaaagaatctcagcaacattcc
aagtcatcagctgacaaaataggagaagtctcttctcccaaggccagttctaagctggca
attatgaaaagaaaagaagagagctcttataaagaaatagagcctgtggcctcaaaaaga
aaagaaaatgccattaaattgaaaggagagacaaaaactcctaagaaaaccaaaagttct
ccagctaaaaaagagtctgtaagtcctgaagattctgaaaagaaacgcactaattatcaa
gcttatcgaagctacttaaatcgagaaggtcccaaggctctgggctccaaagaaatacca
aagggagctgaaaattgcttggaaggccttatatttgtaatcacaggcgtgctggagtct
attgaacgagatgaggccaagtctctaattgaacgttatgggggaaaagtaacaggaaat
gtcagcaagaaaacaaattatcttgtcatgggtcgtgatagtggacagtccaagagtgat
aaggccgcagccttggggacaaaaattattgatgaagatggcctgttgaatctgattcgg
actatgccaggcaagaaatccaagtatgaaatagcagttgaaactgagatgaagaaagag
tccaaactggagagaacaccccaaaaaaatgtccaaggaaaaagaaaaattagtccatct
aaaaaggaatcagaatctaaaaagagcaggccgacttccaaaagggacagtttggcaaag
acaataaaaaaggaaacagatgtgttttggaaaagcctggatttcaaggagcaggtggct
gaggagacaagtggtgacagcaaggctaggaatttggctgatgacagcagtgaaaacaaa
gtggaaaatttgctctgggtggataaatataagccaacctcgctcaagaccataattgga
cagcaaggtgaccagagctgtgccaacaaactcctacgctggctccgaaactggcaaaag
agttcttccgaagataaaaaacacgcagcaaagtttggtaaattttccggcaaagatgat
ggctctagttttaaagcagcgttgctgtcaggccctcctggtgttggcaaaaccaccaca
gcttccctggtgtgtcaggagttgggatacagctacgtggaactgaatgcaagtgacacc
cggagtaagagcagtttgaaggcgattgttgctgagtcactgaacaataccagcatcaaa
ggcttttattcaaatggagcagcctcttcagtaagcacgaaacatgctctcatcatggat
gaagtagatggcatggcaggcaatgaggataggggaggaattcaggaattaattggcctg
ataaaacatactaaaattcccattatttgtatgtgcaatgatagaaatcatcccaagatt
cgctctctggttcattattgttttgatcttcgttttcaaagacctcgggttgaacagatt
aagggtgctatgatgtctattgcatttaaagaaggtttaaagattccccctccagctatg
aatgaaataattttgggagccaatcaagatatcagacaggttttacataatctgagtatg
tggtgtgcacgaagtaaagcattaacctatgaccaggccaaagctgattctcacagagcc
aaaaaggatatcaaaatgggcccatttgatgttgcccggaaagtgtttgcagctggagag
gagactgctcacatgtcacttgtggacaagtcagatctcttttttcatgattattcaata
gcacccctcttcgtccaggaaaattacatacacgtgaagcctgtagcagcagggggtgac
atgaaaaagcacctgatgcttttaagcagagcagcagacagcatatgcgatggtgaccta
gtggacagccagatccggagtaagcaaaactggagtcttctgcctgcgcaggccatttat
gccagtgttcttcctggagagttgatgagggggtacatgacccagtttcccaccttccca
agctggctggggaagcactcgtctacaggcaaacatgatcgtattgttcaggacctggcc
ttgcatatgagtctcagaacttactccagcaaaaggactgtaaacatggattatctgtcg
cttctaagggatgcacttgtacagcccttgacctcacaaggagtagacggagtacaggat
gttgttgcacttatggacacatattatttgatgaaagaagactttgagaatatcatggaa
atcagcagctggggtggcaaacctagtcccttttcaaagctggatcccaaggtgaaagca
gccttcacaagagcttacaataaggaagcccaccttactccatactcacttcaagctata
aaggcatctagacacagcacaagcccatccctggattcggaatacaatgaagaattaaat
gaagatgactctcaatctgatgagaaagaccaagatgctatagaaactgatgccatgatc
aagaaaaagacaaaatcttcaaagccttcaaaaccagaaaaagataaggagcccagaaaa
ggaaaaggaaaaagttcgaagaaatga

DBGET integrated database retrieval system