KEGG   Homo sapiens (human): 5982
Entry
5982              CDS       T01001                                 

Symbol
RFC2, RFC40
Name
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5982 (RFC2)
   03420 Nucleotide excision repair
    5982 (RFC2)
   03430 Mismatch repair
    5982 (RFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5982 (RFC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5982 (RFC2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5982 (RFC2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5982 (RFC2)
  DNA Replication Termination Factors
   ELG1-RFC complex
    5982 (RFC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5982 (RFC2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5982 (RFC2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5982 (RFC2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 AAA_22 Mg_chelatase AAA_24 Viral_helicase1 AAA_11 Rad17 RuvB_N AAA_19 AAA_18 AAA_assoc_2 AAA_5 AAA_25 MipZ DEAD T2SSE ABC_tran AAA_30 AAA_28 NTPase_1 DUF815 AAA_23 FtsK_SpoIIIE RNA_helicase DNA_pol3_delta DUF3383
Other DBs
NCBI-GeneID: 5982
NCBI-ProteinID: NP_852136
OMIM: 600404
HGNC: 9970
Ensembl: ENSG00000049541
Vega: OTTHUMG00000023239
Pharos: P35250(Tbio)
UniProt: P35250
Position
7q11.23
AA seq 354 aa
MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRL
EVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKI
KMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEP
IQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTF
SGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIF
RVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggaggtggaggccgtctgtggtggcgcgggcgaggtggaggcccaggactctgaccct
gcccctgccttcagcaaggcccccggcagcgccggccactacgaactgccgtgggttgaa
aaatataggccagtaaagctgaatgaaattgtcgggaatgaagacaccgtgagcaggcta
gaggtctttgcaagggaaggaaatgtgcccaacatcatcattgcgggccctccaggaacc
ggcaagaccacaagcattctgtgcttggcccgggccctgctgggcccagcactcaaagat
gccatgttggaactcaatgcttcaaatgacaggggcattgacgttgtgaggaataaaatt
aaaatgtttgctcaacaaaaagtcactcttcccaaaggccgacataagatcatcattctg
gatgaagcagacagcatgaccgacggagcccagcaagccttgaggagaaccatggaaatc
tactctaaaaccactcgcttcgcccttgcttgtaatgcttcggataagatcatcgagccc
attcagtcccgctgtgcagtcctccggtacacaaagctgaccgacgcccagatcctcacc
aggctgatgaatgttatcgagaaggagagggtaccctacactgatgacggcctagaagcc
atcatcttcacggcccagggagacatgaggcaggcgctgaacaacctgcagtccaccttc
tcaggatttggcttcattaacagtgagaacgtgttcaaggtctgtgacgagccccaccca
ctgctggtaaaggagatgatccagcactgtgtgaatgccaacattgacgaagcctacaag
attcttgctcacttgtggcatctgggctactcaccagaagatatcattggcaacatcttt
cgagtgtgtaaaactttccaaatggcagaatacctgaaactggagtttatcaaggaaatt
ggatacactcacatgaaaatagcggaaggagtgaactctcttttgcagatggcaggcctc
ctggcaaggctgtgtcagaagacaatggccccggtggccagttag

KEGG   Homo sapiens (human): 5984
Entry
5984              CDS       T01001                                 

Symbol
RFC4, A1, RFC37
Name
(RefSeq) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5984 (RFC4)
   03420 Nucleotide excision repair
    5984 (RFC4)
   03430 Mismatch repair
    5984 (RFC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5984 (RFC4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5984 (RFC4)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5984 (RFC4)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5984 (RFC4)
  DNA Replication Termination Factors
   ELG1-RFC complex
    5984 (RFC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5984 (RFC4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5984 (RFC4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5984 (RFC4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_16 AAA_assoc_2 DUF815 AAA_24 AAA_11 AAA_30 DNA_pol3_delta AAA_22 AAA_19 Mg_chelatase RuvB_N ResIII AAA_5 TIP49_C Viral_helicase1 AAA_23 AAA_28 AAA_7
Other DBs
NCBI-GeneID: 5984
NCBI-ProteinID: NP_002907
OMIM: 102577
HGNC: 9972
Ensembl: ENSG00000163918
Vega: OTTHUMG00000156515
Pharos: P35249(Tbio)
UniProt: P35249
Position
3q27.3
AA seq 363 aa
MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRK
AITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG
HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLS
QNC
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcaagcatttcttaaaggtacatccatcagtactaaacccccgctgaccaaggatcga
ggagtagctgccagtgcgggaagtagcggagagaacaagaaagccaaacccgttccctgg
gtggaaaaatatcgcccaaaatgtgtggatgaagttgctttccaggaagaagtggttgca
gtgctgaaaaaatctttagaaggagcagatcttcctaatctcttgttttacggaccacct
ggaactggaaaaacatccactattttggcagcagctagagaactctttgggcctgaactt
ttccgattaagagttcttgagttaaatgcatctgatgaacgtggaatacaagtagttcga
gagaaagtgaaaaattttgctcaattaactgtgtcaggaagtcgctcagatgggaagccg
tgtccgccttttaagattgtgattctggatgaagcagattctatgacctcagctgctcag
gcagctttaagacgtaccatggagaaggagtcgaaaaccacccgattctgtcttatctgt
aactatgtcagtcgaataattgaacccctgacctctagatgttcaaaattccgcttcaag
cctctgtcagataaaattcaacagcagcgattactagacattgccaagaaggaaaatgtc
aaaattagtgatgagggaatagcttatcttgttaaagtgtcagaaggagacttaagaaaa
gccattacatttcttcaaagcgctactcgattaacaggtggaaaggagatcacagagaaa
gtgattacagacattgccggggtaataccagctgagaaaattgatggagtatttgctgcc
tgtcagagtggctcttttgacaaactagaagctgtggtcaaggatttaatagatgagggt
catgcagcaactcagctcgtcaatcaactccatgatgtggttgtagaaaataacttatct
gataaacagaagtctattatcacagaaaaacttgccgaagttgacaaatgcctagcagat
ggtgctgatgaacatttgcaactcatcagcctttgtgcaactgtgatgcagcagttatct
cagaattgttaa

DBGET integrated database retrieval system