KEGG   Homo sapiens (human): 5985
Entry
5985              CDS       T01001                                 
Symbol
RFC5, RFC36
Name
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Network
nt06503  Mismatch repair
nt06504  Base excision repair
nt06506  Double-strand break repair
  Element
N01432  Mismatch repair
N01436  Long patch BER
N01452  Homologous recombination
N01471  Origin unwinding and elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5985 (RFC5)
   03420 Nucleotide excision repair
    5985 (RFC5)
   03430 Mismatch repair
    5985 (RFC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5985 (RFC5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5985 (RFC5)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5985 (RFC5)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    5985 (RFC5)
  DNA Replication Termination Factors
   ELG1-RFC complex
    5985 (RFC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    5985 (RFC5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     5985 (RFC5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    5985 (RFC5)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_24 AAA_16 AAA_22 AAA_11 AAA_assoc_2 RuvB_N AAA_19 ResIII DUF815 AAA_14 AAA_5 DNA_pol3_delta DEAD PhoH TniB TIP49 AAA_30 AAA_7 T2SSE ATPase_2 Mg_chelatase AAA_25 bpMoxR IstB_IS21 AAA_3 Thioredoxin_6
Other DBs
NCBI-GeneID: 5985
NCBI-ProteinID: NP_031396
OMIM: 600407
HGNC: 9973
Ensembl: ENSG00000111445
Pharos: P40937(Tbio)
UniProt: P40937
Structure
Position
12:118016703..118041448
AA seq 340 aa
METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYG
PPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFK
LVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPE
LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTG
HPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIH
LLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggagacctcagcactcaagcagcaggagcagcccgcggcgaccaagatcaggaacctg
ccctgggttgaaaaataccggccacagaccctgaatgatctcatttctcatcaggacatt
ctgagtaccattcagaagtttatcaatgaagaccgactgccacacttgcttctctacggt
cccccagggacaggcaagacatctaccatcctagcctgtgcgaaacagctatataaagac
aaagaatttggctccatggtcttggagctgaatgcttcagatgaccgaggaatagacatc
attcgaggaccgatcctgagctttgctagcacaaggacaatatttaagaaaggctttaag
ctagtgatcttggatgaagcagacgccatgactcaggacgcccagaatgccttgagaaga
gtaattgagaaattcacagaaaataccagattctgcctcatctgtaactatctgtcaaag
atcatccctgccttgcagtcccgctgcacgaggtttcggttcggtcccctgactcctgaa
ctcatggttccccgcctggaacatgtcgtggaagaagagaaagttgatataagtgaagat
ggaatgaaagcactagtcactctttccagtggagacatgcgtagggctctgaacattttg
cagagcaccaatatggcctttgggaaggtgacagaggagactgtctacacctgcaccggg
cacccgctcaagtcagacattgccaacatcctggactggatgttgaatcaagatttcacc
acagcctacagaaatattacagagttgaaaactctgaaggggttggcactgcatgatatc
ctgacagagatacacttgtttgtgcatagagttgactttccatcttcagttcgaatacat
ttattgaccaaaatggcagacattgagtacaggctttctgttggcaccaacgagaagatc
cagctgagctccctcattgctgcatttcaagtcaccagagacctgattgttgcagaggcc
tag

DBGET integrated database retrieval system