KEGG   Homo sapiens (human): 5987Help
Entry
5987              CDS       T01001                                 

Gene name
TRIM27, RFP, RNF76
Definition
(RefSeq) tripartite motif containing 27
  KO
K12009  tripartite motif-containing protein 27 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     5987 (TRIM27)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    5987 (TRIM27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY SPRY zf-B_box zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-RING_4 Baculo_IE-1
Motif
Other DBs
NCBI-GeneID: 5987
NCBI-ProteinID: NP_006501
OMIM: 602165
HGNC: 9975
Ensembl: ENSG00000204713
Vega: OTTHUMG00000031215
Pharos: P14373(Tbio)
UniProt: P14373 A0A1U9X8R9
Position
6p22.1
AA seq 513 aa AA seqDB search
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgggagtgtggccgagtgcctgcagcaggagaccacctgccccgtgtgcctg
cagtacttcgcagagcccatgatgctcgactgcggccataacatctgttgcgcgtgcctc
gcccgctgctggggcacggcagagactaacgtgtcgtgcccgcagtgccgggagaccttc
ccgcagaggcacatgcggcccaaccggcacctggccaacgtgacccaactggtaaagcag
ctgcgcaccgagcggccgtcggggcccggcggcgagatgggcgtgtgcgagaagcaccgc
gagcccctgaagctgtactgcgaggaggaccagatgcccatctgcgtggtgtgcgaccgc
tcccgcgagcaccgcggccacagcgtgctgccgctcgaggaggcggtggagggcttcaag
gagcaaatccagaaccagctcgaccatttaaaaagagtgaaagatttaaagaagagacgt
cgggcccagggggaacaggcacgagctgaactcttgagcctaacccagatggagagggag
aagattgtttgggagtttgagcagctgtatcactccttaaaggagcatgagtatcgcctc
ctggcccgccttgaggagctagacttggccatctacaatagcatcaatggtgccatcacc
cagttctcttgcaacatctcccacctcagcagcctgatcgctcagctagaagagaagcag
cagcagcccaccagggagctcctgcaggacattggggacacattgagcagggctgaaaga
atcaggattcctgaaccttggatcacacctccagatttgcaagagaaaatccacattttt
gcccaaaaatgtctattcttgacggagagtctaaagcagttcacagaaaaaatgcagtca
gatatggagaaaatccaagaattaagagaggctcagttatactcagtggacgtgactctg
gacccagacacggcctaccccagcctgatcctctctgataatctgcggcaagtgcggtac
agttacctccaacaggacctgcctgacaaccccgagaggttcaatctgtttccctgtgtc
ttgggctctccatgcttcatcgccgggagacattattgggaggtagaggtgggagataaa
gccaagtggaccataggtgtctgtgaagactcagtgtgcagaaaaggtggagtaacctca
gccccccagaatggattctgggcagtgtctttgtggtatgggaaagaatattgggctctt
acctccccaatgactgccctacccctgcggaccccgctccagcgggtggggattttcttg
gactatgatgctggtgaggtctccttctacaacgtgacagagaggtgtcacaccttcact
ttctctcatgctaccttttgtgggcctgtccggccctacttcagtctgagttactcggga
gggaaaagtgcagctcctctgatcatctgccccatgagtgggatagatgggttttctggc
catgttgggaatcatggtcattccatggagacctccccttga

DBGET integrated database retrieval system