KEGG   Homo sapiens (human): 5997Help
Entry
5997              CDS       T01001                                 

Gene name
RGS2, G0S8
Definition
(RefSeq) regulator of G protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04740  Olfactory transduction
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    5997 (RGS2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    5997 (RGS2)
  Sensory system
   04740 Olfactory transduction
    5997 (RGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS COMPASS-Shg1
Motif
Other DBs
NCBI-GeneID: 5997
NCBI-ProteinID: NP_002914
OMIM: 600861
HGNC: 9998
Ensembl: ENSG00000116741
Vega: OTTHUMG00000035600
Pharos: P41220(Tbio)
UniProt: P41220 A0A024R939
Structure
PDB: 

Position
1q31.2
AA seq 211 aa AA seqDB search
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgctatgttcttggctgttcaacacgactgcagacccatggacaagagcgca
ggcagtggccacaagagcgaggagaagcgagaaaagatgaaacggacccttttaaaagat
tggaagacccgtttgagctacttcttacaaaattcctctactcctgggaagcccaaaacc
ggcaaaaaaagcaaacagcaagctttcatcaagccttctcctgaggaagcacagctgtgg
tcagaagcatttgacgagctgctagccagcaaatatggtcttgctgcattcagggctttt
ttaaagtcggaattctgtgaagaaaatattgaattctggctggcctgtgaagacttcaaa
aaaaccaaatcaccccaaaagctgtcctcaaaagcaaggaaaatatatactgacttcata
gaaaaggaagctccaaaagagataaacatagattttcaaaccaaaactctgattgcccag
aatatacaagaagctacaagtggctgctttacaactgcccagaaaagggtatacagcttg
atggagaacaactcttatcctcgtttcttggagtcagaattctaccaggacttgtgtaaa
aagccacaaatcaccacagagcctcatgctacatga

DBGET integrated database retrieval system