KEGG   Homo sapiens (human): 5998
Entry
5998              CDS       T01001                                 

Symbol
RGS3, C2PA, RGP3
Name
(RefSeq) regulator of G protein signaling 3
  KO
K07524  regulator of G-protein signalling 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    5998 (RGS3)
SSDB
Motif
Pfam: RGS C2 PDZ PDZ_6 PDZ_2 CEP76-C2
Other DBs
NCBI-GeneID: 5998
NCBI-ProteinID: NP_652759
OMIM: 602189
HGNC: 9999
Ensembl: ENSG00000138835
Vega: OTTHUMG00000021048
Pharos: P49796(Tbio)
UniProt: P49796
Structure
PDB: 
3FBK 2OJ4 2F5Y

Position
9q32
AA seq 1094 aa
MEWLSPDIALPRRDEWTQTSPARKRITHAKVQGAGQLRLSIDAQDRVLLLHIIEGKGLIS
KQPGTCDPYVKISLIPEDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWN
RASQSRQSGLIGCMSFGVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLL
RMPGGGDTENGKKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQL
NERPVEHWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPN
KREKNCTHGVQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPT
DPNYIILAPLNPGSQLLRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGN
YQNCPVVRPHATHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKA
AEVTLFAYSDLLLFTKEDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLF
TLEAHSQEQKKRVCWCLSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGAEDS
PPSKEPSPGQELPPGQDLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDV
PPCQEPPPAQDLSPCQDLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSL
PAKALTEDTMSSGDLLAATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEE
AEEVEEGEEGEEDEDEDTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSE
GSLLQEPRGPCFASDTTLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHR
KMSGADTVGDDDEASRKRKSKNLAKDMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTS
EEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKK
IFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDL
YLDLINQKKMSPPL
NT seq 3285 nt   +upstreamnt  +downstreamnt
atggagtggctaagccctgatatcgctctgcccagaagagatgagtggactcaaacttct
ccagccaggaagaggatcacgcatgccaaagtccagggtgcaggtcagctgaggctgtcc
attgatgcccaggaccgggttctgctgcttcacattatagaaggtaaaggcctgatcagc
aaacagcctggcacctgtgatccgtatgtgaagatttctttgatccctgaagatagtaga
ctacgccaccagaagacgcagaccgttccagactgcagagacccggctttccacgagcac
ttcttctttcctgtccaagaggaggatgatcagaagcgtctcttggttactgtgtggaac
agggccagccagtccagacagagtggactcattggctgcatgagctttggggtgaagtct
ctcctgactccagacaaggagatcagtggttggtactacctcctaggggagcacctgggc
cggaccaagcacttgaaggtggccaggcggcgactgcggccgctgagagacccgctgctg
agaatgccaggaggtggggacactgagaatgggaagaaactaaagatcaccatcccgagg
ggaaaggacggctttggcttcaccatctgctgcgactctccagttcgagtccaggccgtg
gattccgggggtccggcggaacgggcagggctgcagcagctggacacggtgctgcagctg
aatgagaggcctgtggagcactggaaatgtgtggagctggcccacgagatccggagctgc
cccagtgagatcatcctactcgtgtggcgcatggtcccccaggtcaagccaggaccagat
ggcggggtcctgcggcgggcctcctgcaagtcgacacatgacctccagtcaccccccaac
aaacgggagaagaactgcacccatggggtccaggcacggcctgagcagcgccacagctgc
cacctggtatgtgacagctctgatgggctgctgctcggcggctgggagcgctacaccgag
gtggccaagcgcgggggccagcacaccctgcctgcactgtcccgtgccactgcccccacc
gaccccaactacatcatcctggccccgctgaatcctgggagccagctgctccggcctgtg
taccaggaggataccatccccgaagaatcagggagtcccagtaaagggaagtcctacaca
ggcctggggaagaagtcccggctgatgaagacagtgcagaccatgaagggccacgggaac
taccaaaactgcccggttgtgaggccgcatgccacgcactcaagctatggcacctacgtc
accctggcccccaaagtcctggtgttccctgtctttgttcagcctctagatctctgtaat
cctgcccggaccctcctgctgtcagaggagctgctgctgtatgaagggaggaacaaggct
gccgaggtgacactgtttgcctattcggacctgctgctcttcaccaaggaggacgagcct
ggccgctgcgacgtcctgaggaaccccctctacctccagagtgtgaagctgcaggaaggt
tcttcagaagacctgaaattctgcgtgctctatctagcagagaaggcagagtgcttattc
actttggaagcgcactcgcaggagcagaagaagagagtgtgctggtgcctgtcggagaac
atcgccaagcagcaacagctggcagcatcacccccggacagcaagatgtttgagacggag
gcagatgagaagagggagatggccttggaggaagggaaggggcctggtgccgaggattcc
ccacccagcaaggagccctctcctggccaggagcttcctccaggacaagaccttccaccc
aacaaggactccccttctgggcaggaacccgctcccagccaagaaccactgtccagcaaa
gactcagctacctctgaaggatcccctccaggcccagatgctccgcccagcaaggatgtg
ccaccatgccaggaaccccctccagcccaagacctctcaccctgccaggacctacctgct
ggtcaagaacccctgcctcaccaggaccctctactcaccaaagacctccctgccatccag
gaatcccccacccgggaccttccaccctgtcaagatctgcctcctagccaggtctccctg
ccagccaaggcccttactgaggacaccatgagctccggggacctactagcagctactggg
gacccacctgcggcccccaggccagccttcgtgatccctgaggtccggctggatagcacc
tacagccagaaggcaggggcagagcagggctgctcgggagatgaggaggatgcagaagag
gccgaggaggtggaggagggggaggaaggggaggaggacgaggatgaggacaccagcgat
gacaactacggagagcgcagtgaggccaagcgcagcagcatgatcgagacgggccagggg
gctgagggtggcctctcactgcgtgtgcagaactcgctgcggcgccggacgcacagcgag
ggcagcctgctgcaggagccccgagggccctgctttgcctccgacaccaccttgcactgc
tcagacggtgagggcgccgcctccacctggggcatgccttcgcccagcaccctcaagaaa
gagctgggccgcaatggtggctccatgcaccacctttccctcttcttcacaggacacagg
aagatgagcggggctgacaccgttggggatgatgacgaagcctcccggaagagaaagagc
aaaaacctagccaaggacatgaagaacaagctggggatcttcagacggcggaatgagtcc
cctggagcccctcccgcgggcaaggcagacaaaatgatgaagtcattcaagcccacctca
gaggaagccctcaagtggggcgagtccttggagaagctgctggttcacaaatacgggtta
gcagtgttccaagccttccttcgcactgagttcagtgaggagaatctggagttctggttg
gcttgtgaggacttcaagaaggtcaagtcacagtccaagatggcatccaaggccaagaag
atctttgctgaatacatcgcgatccaggcatgcaaggaggtcaacctggactcctacacg
cgggagcacaccaaggacaacctgcagagcgtcacgcggggctgcttcgacctggcacag
aagcgcatcttcgggctcatggaaaaggactcgtaccctcgctttctccgttctgacctc
tacctggaccttattaaccagaagaagatgagtcccccgctttag

DBGET integrated database retrieval system