KEGG   Homo sapiens (human): 5999Help
Entry
5999              CDS       T01001                                 

Gene name
RGS4, RGP4, SCZD9
Definition
(RefSeq) regulator of G protein signaling 4
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    5999 (RGS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS
Motif
Other DBs
NCBI-GeneID: 5999
NCBI-ProteinID: NP_005604
OMIM: 602516
HGNC: 10000
Ensembl: ENSG00000117152
Vega: OTTHUMG00000034417
Pharos: P49798(Tchem)
UniProt: P49798 A0A024R909
Position
1q23.3
AA seq 205 aa AA seqDB search
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNP
SSCGAEKQKGAKSSADCASLVPQCA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaagggcttgcaggtctgccggcttcttgcttgaggagtgcaaaagatatgaaa
catcggctaggtttcctgctgcaaaaatctgattcctgtgaacacaattcttcccacaac
aagaaggacaaagtggttatttgccagagagtgagccaagaggaagtcaagaaatgggct
gaatcactggaaaacctgattagtcatgaatgtgggctggcagctttcaaagctttcttg
aagtctgaatatagtgaggagaatattgacttctggatcagctgtgaagagtacaagaaa
atcaaatcaccatctaaactaagtcccaaggccaaaaagatctataatgaattcatctca
gtccaggcaaccaaagaggtgaacctggattcttgcaccagggaagagacaagccggaac
atgctagagcctacaataacctgctttgatgaggcccagaagaagattttcaacctgatg
gagaaggattcctaccgccgcttcctcaagtctcgattctatcttgatttggtcaacccg
tccagctgtggggcagaaaagcagaaaggagccaagagttcagcagactgtgcttccctg
gtccctcagtgtgcctaa

DBGET integrated database retrieval system