KEGG   Homo sapiens (human): 6000Help
Entry
6000              CDS       T01001                                 

Gene name
RGS7
Definition
(RefSeq) regulator of G protein signaling 7
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    6000 (RGS7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS_DHEX RGS DEP G-gamma RGS-like
Motif
Other DBs
NCBI-GeneID: 6000
NCBI-ProteinID: NP_002915
OMIM: 602517
HGNC: 10003
Ensembl: ENSG00000182901
Vega: OTTHUMG00000040107
Pharos: P49802(Tbio)
UniProt: P49802
Structure
PDB: 

Position
1q43; 1q23.1
AA seq 487 aa AA seqDB search
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGKSLTSKRL
TSLAQSY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggggaataattatgggcagaccagcaacggggtggccgatgaatcacccaac
atgctggtgtacagaaagatggaagacgtcatagcacggatgcaagatgaaaaaaatgga
attcctattcgtacggtcaaaagctttctttccaagatacctagcgtcttctctggttca
gacattgttcaatggttgataaagaacttaactatagaagatccagtggaggcgctccat
ttgggaacattaatggctgcccacggctacttctttccaatctcagatcatgtcctcaca
ctcaaggatgatggcaccttttaccggtttcaaaccccctatttttggccatcaaattgt
tgggagccggaaaacacagattatgccgtttacctctgcaagagaacaatgcaaaacaag
gcacgactggagctcgcagactatgaggctgagagcctggccaggctgcagagagcattt
gcccggaagtgggagttcattttcatgcaagcagaagcacaagcaaaagtggacaagaag
agagacaagattgaaaggaagatccttgacagccaagagagagcgttctgggacgtgcac
aggcccgtgcctggatgtgtaaatacaactgaagtggacattaagaagtcatccagaatg
agaaacccccacaaaacacggaagtctgtctatggtttacaaaatgatattagaagtcac
agtcctacccacacacccacaccagaaactaaacctccaacagaagatgagttacaacaa
cagataaaatattggcaaatacagttagatagacatcggttaaaaatgtcaaaagtcgct
gacagtctactaagttacacggaacagtatttagaatacgacccgtttcttttgccacct
gacccttctaacccatggctgtccgatgacaccactttctgggaacttgaggcaagcaaa
gaaccgagccagcagagggtaaaacgatggggttttggcatggacgaggcattgaaagac
ccagttgggagagaacagttccttaaatttctagagtcagaattcagctcggaaaattta
agattctggctggcagtggaggacctgaaaaagaggcctattaaagaagtaccctcaaga
gttcaggaaatatggcaagagtttctggctcccggagcccccagtgctattaacttggat
tccaagagttatgacaaaaccacacagaacgtgaaggaacctggacgatacacatttgaa
gatgctcaggagcacatttacaaactgatgaaaagtgattcatacccacgttttataaga
tccagtgcctatcaggagcttctacaggcaaagaaaaagtctggaaactcaatggatcgc
agaacatcttttgaaaaatttgcacagaatgtggggaaatctctcacgtccaagaggtta
acaagccttgctcagtcttactaa

DBGET integrated database retrieval system