KEGG   Homo sapiens (human): 6001Help
Entry
6001              CDS       T01001                                 

Gene name
RGS10
Definition
(RefSeq) regulator of G protein signaling 10
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    6001 (RGS10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS RGS-like
Motif
Other DBs
NCBI-GeneID: 6001
NCBI-ProteinID: NP_002916
OMIM: 602856
HGNC: 9992
Ensembl: ENSG00000148908
Vega: OTTHUMG00000019150
Pharos: O43665(Tbio)
UniProt: O43665
Structure
PDB: 

Position
10q26.11
AA seq 167 aa AA seqDB search
MEHIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLAC
EDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQI
FNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggaacacatccacgacagcgatggcagttccagcagcagccaccagagcctcaagagc
acagccaaatgggcggcatccctggagaatctgctggaagacccagaaggcgtgaaaaga
tttagggaatttttaaaaaaggaattcagtgaagaaaatgttttgttttggctagcatgt
gaagattttaagaaaatgcaagataagacgcagatgcaggaaaaggcaaaggagatctac
atgacctttctgtccagcaaggcctcatcacaggtcaacgtggaggggcagtctcggctc
aacgagaagatcctggaagaaccgcaccctctgatgttccagaaactccaggaccagatc
tttaatctcatgaagtacgacagctacagccgcttcttaaagtctgacttgtttttaaaa
cacaagcgaaccgaggaagaggaagaagatttgcctgatgctcaaactgcagctaaaaga
gcttccagaatttataacacatga

DBGET integrated database retrieval system