KEGG   Homo sapiens (human): 6004
Entry
6004              CDS       T01001                                 

Gene name
RGS16, A28-RGS14, A28-RGS14P, RGS-R
Definition
(RefSeq) regulator of G protein signaling 16
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    6004 (RGS16)
Motif
Pfam: RGS Arteri_nsp7a
Other DBs
NCBI-GeneID: 6004
NCBI-ProteinID: NP_002919
OMIM: 602514
HGNC: 9997
Ensembl: ENSG00000143333
Vega: OTTHUMG00000035212
Pharos: O15492(Tbio)
UniProt: O15492
Structure
PDB: 
2BT2 2IK8

Position
1q25.3
AA seq 202 aa
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVL
GWRESFDLLLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEE
FICSEAPKEVNIDHETHELTRMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASATLSSCSLDEPSHT
NT seq 609 nt   +upstreamnt  +downstreamnt
atgtgccgcaccctggccgccttccccaccacctgcctggagagagccaaagagttcaag
acacgtctggggatctttcttcacaaatcagagctgggctgcgatactgggagtactggc
aagttcgagtggggcagtaaacacagcaaagagaatagaaacttctcagaagatgtgctg
gggtggagagagtcgttcgacctgctgctgagcagtaaaaatggagtggctgccttccac
gctttcctgaagacagagttcagtgaggagaacctggagttctggctggcctgtgaggag
ttcaagaagatccgatcagctaccaagctggcctccagggcacaccagatctttgaggag
ttcatttgcagtgaggcccctaaagaggtcaacattgaccatgagacccacgagctgacg
aggatgaacctgcagactgccacagccacatgctttgatgcggctcaggggaagacacgt
accctgatggagaaggactcctacccacgcttcctgaagtcgcctgcttaccgggacctg
gctgcccaagcctcagccgcctctgccactctgtccagctgcagcctggacgagccctca
cacacctga

DBGET integrated database retrieval system