KEGG   Homo sapiens (human): 6005Help
Entry
6005              CDS       T01001                                 

Gene name
RHAG, CD241, OHS, OHST, RH2, RH50A, RHNR, Rh50, Rh50GP, SLC42A1
Definition
(RefSeq) Rh associated glycoprotein
  KO
K06580  ammonium transporter Rh
Organism
hsa  Homo sapiens (human)
Disease
H00232  Hereditary stomatocytosis
H01214  Rh-null hemolytic anemia (RHN)
H01979  Overhydrated hereditary stomatocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6005 (RHAG)
   04090 CD molecules [BR:hsa04090]
    6005 (RHAG)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC42: Rh ammonium transporter
   6005 (RHAG)
CD molecules [BR:hsa04090]
 Proteins
  6005 (RHAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp AzlD
Motif
Other DBs
NCBI-GeneID: 6005
NCBI-ProteinID: NP_000315
OMIM: 180297
HGNC: 10006
Ensembl: ENSG00000112077
Vega: OTTHUMG00000016377
Pharos: Q02094(Tbio)
UniProt: Q02094 Q96E98
Position
6p12.3
AA seq 409 aa AA seqDB search
MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVM
IFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADF
SAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAY
FGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAI
VNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIG
SIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAM
QAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcacattccctctcatggctatagtcctggaaattgccatgattgttttattt
ggattatttgttgagtatgaaacggaccagactgttctcgagcagctcaacatcaccaag
ccaacagacatgggcatattctttgagttatatcctctgttccaagatgtacatgttatg
atatttgttgggtttggcttcctcatgaccttcctgaagaaatatggcttcagcagtgtg
ggtatcaacctactcgttgctgctttgggcctccagtggggcactattgtacagggaatc
ctgcaaagccagggacagaaatttaacattggaatcaaaaacatgataaatgcagacttc
agtgcagccacagttctgatatcttttggagctgtcctgggaaaaacgagccccacccaa
atgctgatcatgacaattttagaaattgttttctttgcccacaatgaatacctggttagt
gaaatatttaaggcctctgacattggagcatcaatgacgatccatgcctttggggcctac
tttggcttggctgtagcaggcatcttgtatcgatctggactgagaaaggggcatgaaaat
gaagagtccgcatactactcagacttgtttgcaatgattgggactctctttctgtggatg
ttttggcccagctttaactcggccattgctgaacctggagacaaacagtgcagggccatt
gtaaacacgtacttctctctcgctgcctgtgtgctcacagcctttgccttctccagccta
gtggagcaccgaggcaagctcaacatggttcacattcagaatgccacccttgctggagga
gttgctgtgggcacttgtgcggatatggcaattcacccatttggttctatgattattggg
agcattgcaggaatggtctctgtgcttggatacaagttcctgactccactttttactact
aaactgaggatccatgatacatgtggggtccataacctccacggcttacctggtgtagtg
ggaggccttgcaggcattgtggcagtagcaatgggcgcctccaacacgtctatggccatg
caggcagctgcactgggttcctctatcggaacagcagttgttggaggtctgatgacaggt
ttaattctaaagttgcctctctggggacagccatctgaccagaactgctatgatgattct
gtttattggaaggtccctaagacgagataa

DBGET integrated database retrieval system