KEGG   Homo sapiens (human): 6011Help
Entry
6011              CDS       T01001                                 

Gene name
GRK1, GPRK1, RHOK, RK
Definition
(RefSeq) G protein-coupled receptor kinase 1
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04744  Phototransduction
Disease
H00787  Congenital stationary night blindness
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6011 (GRK1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6011 (GRK1)
  09157 Sensory system
   04744 Phototransduction
    6011 (GRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6011 (GRK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     6011 (GRK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   6011 (GRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 6011
NCBI-ProteinID: NP_002920
OMIM: 180381
HGNC: 10013
Ensembl: ENSG00000185974
Vega: OTTHUMG00000185528
Pharos: Q15835(Tchem)
UniProt: Q15835
Structure
PDB: 

Position
13q34
AA seq 563 aa AA seqDB search
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFES
VCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAK
LFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWL
EAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKK
ILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRALFYTAQ
IICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMA
PELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFS
QASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVY
AKDIQDVGAFSTVKGVAFDKTDTEFFQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQM
PDDMKGISGGSSSSSKSGMCLVS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgggtctttggagaccgtggtggccaactctgccttcatcgccgcccgaggc
agctttgacggcagcagctcccaaccctcccgggacaagaagtacctggccaagctcaag
ctgcccccgctgtccaagtgtgagtccctccgcgacagcctcagcctggagtttgagagt
gtgtgcttggagcagcccatcggcaagaagctctttcagcagttcctacaatcggcagag
aagcacctgccggccctggagctctggaaagacatcgaggactatgacacggcagacaat
gacctccagccacagaaggcccagaccatcctggcccagtacctggacccccaggccaaa
ctcttctgcagcttcctggatgaggggatagtggcgaagtttaaggaggggcctgtggag
atccaggacgggctcttccagcccctgctgcaggccaccctggcacacctgggccaagcc
cccttccaggagtacctgggcagcctgtacttcctgaggttcctgcagtggaagtggctg
gaagcccagcccatgggggaggactggttcctggacttcagggtcctagggaaagggggc
ttcggggaggtgtcggcctgccagatgaaggcgaccggcaagctgtatgcctgcaagaag
ctgaacaagaagcggctgaagaagaggaagggctaccagggtgctatggtggagaagaag
attctgatgaaagtacacagcaggttcatcgtgtctctggcctatgcgtttgaaaccaaa
gccgacctctgtctggtgatgaccatcatgaacggaggtgacatcaggtaccacatctac
aacgtgaatgaggagaaccctggcttcccggagccgcgcgccctcttctacacggcgcag
atcatctgcggcctggagcacctgcaccagaggcggatcgtctaccgcgacctcaagccc
gagaacgtgctgctggacaatgacggcaatgtccggatctctgaccttgggctggccgtg
gagctgctggacggacagagcaagaccaagggctacgcagggaccccaggtttcatggcc
cccgagctcctgcagggcgaggagtacgacttctccgtggactactttgccctgggggtc
accctgtatgagatgattgcggccagaggacccttccgagcccgtggagagaaggtggag
aacaaggagctgaagcaccggatcatctcagagcccgtgaagtaccctgataagttcagc
caggccagcaaggacttctgcgaggcgctgctggagaaggacccggagaagcgcctgggg
ttcagagatgagacctgcgacaagctccgtgcccaccccctcttcaaggaccttaactgg
aggcagctggaggctgggatgctgatgccccctttcatcccagactccaaaactgtctac
gcaaaggatattcaggacgtgggtgccttttccaccgtcaaaggtgtggcctttgacaaa
acagacacagaattctttcaggaatttgccactggcaactgccccatcccctggcaggag
gagatgatcgagacgggcatctttggcgagctgaacgtgtggcgctcggacggtcagatg
ccggacgacatgaagggcatctccgggggctccagctcctcgtccaagtcagggatgtgt
ctggtttcctag

DBGET integrated database retrieval system