KEGG   Homo sapiens (human): 6014
Entry
6014              CDS       T01001                                 
Symbol
RIT2, RIBA, RIN, ROC2
Name
(RefSeq) Ras like without CAAX 2
  KO
K07833  Ras-like without CAAX 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    6014 (RIT2)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Rit
    6014 (RIT2)
SSDB
Motif
Pfam: Ras Roc Arf ATP_bind_1 GTP_EFTU
Other DBs
NCBI-GeneID: 6014
NCBI-ProteinID: NP_002921
OMIM: 609592
HGNC: 10017
Ensembl: ENSG00000152214
Pharos: Q99578(Tbio)
UniProt: Q99578
Position
18:complement(42743227..43115685)
AA seq 217 aa
MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQ
VRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQV
RHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVRE
IRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggtagaaaatgaagccagctgctccccgggcagcgcatcaggcgggtccagagag
tacaaggtggtaatgctgggagcagggggagttggtaaaagcgcaatgacaatgcagttt
attagtcatcagttccctgattatcatgaccctactatagaagatgcttataagacccag
gtcaggattgacaatgagccagcttacttggacatcttggacactgctggccaggcagaa
ttcacagccatgcgggagcagtacatgcgaggtggggaaggcttcatcatctgctactcc
gtcactgaccgtcaatcatttcaggaggctgccaagtttaaagagctcatttttcaggtc
cgccacacctatgaaattcccctggtgctggtgggtaacaaaattgatctggaacagttc
cgccaggtttctacagaagaaggcttgagtcttgcccaagaatataattgtggttttttt
gagacctctgcagccctcagattctgtattgatgatgcttttcatggcttagtgagggaa
attcgcaagaaggagtccatgccatccttgatggaaaagaaactgaagagaaaagacagc
ctgtggaagaagctcaaaggttctttgaagaagaagagagaaaatatgacatga

DBGET integrated database retrieval system