KEGG   Homo sapiens (human): 6016Help
Entry
6016              CDS       T01001                                 

Gene name
RIT1, NS8, RIBB, RIT, ROC1
Definition
(RefSeq) Ras like without CAAX 1
  KO
K07832  Ras-like without CAAX 1
Organism
hsa  Homo sapiens (human)
Disease
H00523  Noonan syndrome and related disorders
H01738  Noonan syndrome
Brite
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Ras Family
   Rit
    6016 (RIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 6016
NCBI-ProteinID: NP_008843
OMIM: 609591
HGNC: 10023
Ensembl: ENSG00000143622
Vega: OTTHUMG00000014104
Pharos: Q92963(Tbio)
UniProt: Q92963
Structure
PDB: 

Position
1q22
AA seq 219 aa AA seqDB search
MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKI
RIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYR
VRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVR
EIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggattctggaactcgcccagttggtagctgctgtagcagccccgctgggctctcacgg
gagtacaaactagtgatgctgggtgctggtggtgtagggaagagtgccatgaccatgcag
ttcatcagccaccgattcccagaagatcatgatcccaccattgaagatgcttataagatc
aggatccgtattgatgatgagcctgccaatctggacattttggatacagctggacaggca
gagtttacagccatgcgggaccagtatatgagggcaggagaagggtttatcatctgttac
tctatcacggatcgtcgaagtttccatgaagttcgtgagtttaaacagcttatttatcga
gtccgacgtactgacgatacacctgtggttcttgtgggaaacaagtcagacctcaaacag
ctaagacaggtcaccaaggaagaaggattggccttggcccgagaattcagctgtcccttt
tttgagacatctgctgcataccgctactatattgatgatgttttccatgcccttgtacgg
gagatacgtaggaaagaaaaggaggcagtactggccatggagaaaaaatctaagcccaaa
aacagtgtatggaagaggctaaaatcaccattccggaagaagaaagattcagtaacttga

DBGET integrated database retrieval system