KEGG   Homo sapiens (human): 6018
Entry
6018              CDS       T01001                                 
Symbol
RLF, ZN-15L, ZNF292L
Name
(RefSeq) RLF zinc finger
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 FOXP-CC
Other DBs
NCBI-GeneID: 6018
NCBI-ProteinID: NP_036553
OMIM: 180610
HGNC: 10025
Ensembl: ENSG00000117000
Pharos: Q13129(Tbio)
UniProt: Q13129
Position
1:40161387..40240921
AA seq 1914 aa
MADGKGDAAAVAGAGAEAPAVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETEL
REQEVSEVSSLNYCRSFCQTLLQYASNKNASEHIVYLLEVYRLAIQSFASARPYLTTECE
DVLLVLGRLVLSCFELLLSVSESELPCEVWLPFLQSLQESHDALLEFGNNNLQILVHVTK
EGVWKNPVLLKILSQQPVETEEVNKLIAQEGPSFLQMRIKHLLKSNCIPQATALSKLCAE
SKEISNVSSFQQAYITCLCSMLPNEDAIKEIAKVDCKEVLDIICNLESEGQDNTAFVLCT
TYLTQQLQTASVYCSWELTLFWSKLQRRIDPSLDTFLERCRQFGVIAKTQQHLFCLIRVI
QTEAQDAGLGVSILLCVRALQLRSSEDEEMKASVCKTIACLLPEDLEVRRACQLTEFLIE
PSLDGFNMLEELYLQPDQKFDEENAPVPNSLRCELLLALKAHWPFDPEFWDWKTLKRHCH
QLLGQEASDSDDDLSGYEMSINDTDVLESFLSDYDEGKEDKQYRRRDLTDQHKEKRDKKP
IGSSERYQRWLQYKFFCLLCKRECIEARILHHSKMHMEDGIYTCPVCIKKFKRKEMFVPH
VMEHVKMPPSRRDRSKKKLLLKGSQKGICPKSPSAIPEQNHSLNDQAKGESHEYVTFSKL
EDCHLQDRDLYPCPGTDCSRVFKQFKYLSVHLKAEHQNNDENAKHYLDMKNRREKCTYCR
RHFMSAFHLREHEQVHCGPQPYMCVSIDCYARFGSVNELLNHKQKHDDLRYKCELNGCNI
VFSDLGQLYHHEAQHFRDASYTCNFLGCKKFYYSKIEYQNHLSMHNVENSNGDIKKSVKL
EESATGEKQDCINQPHLLNQTDKSHLPEDLFCAESANSQIDTETAENLKENSDSNSSDQL
SHSSSASMNEELIDTLDHSETMQDVLLSNEKVFGPSSLKEKCSSMAVCFDGTKFTCGFDG
CGSTYKNARGMQKHLRKVHPYHFKPKKIKTKDLFPSLGNEHNQTTEKLDAEPKPCSDTNS
DSPDEGLDHNIHIKCKREHQGYSSESSICASKRPCTEDTMLELLLRLKHLSLKNSITHGS
FSGSLQGYPSSGAKSLQSVSSISDLNFQNQDENMPSQYLAQLAAKPFFCELQGCKYEFVT
REALLMHYLKKHNYSKEKVLQLTMFQHRYSPFQCHICQRSFTRKTHLRIHYKNKHQIGSD
RATHKLLDNEKCDHEGPCSVDRLKGDCSAELGGDPSSNSEKPHCHPKKDECSSETDLESS
CEETESKTSDISSPIGSHREEQEGREGRGSRRTVAKGNLCYILNKYHKPFHCIHKTCNSS
FTNLKGLIRHYRTVHQYNKEQLCLEKDKARTKRELVKCKKIFACKYKECNKRFLCSKALA
KHCSDSHNLDHIEEPKVLSEAGSAARFSCNQPQCPAVFYTFNKLKHHLMEQHNIEGEIHS
DYEIHCDLNGCGQIFTHRSNYSQHVYYRHKDYYDDLFRSQKVANERLLRSEKVCQTADTQ
GHEHQTTRRSFNAKSKKCGLIKEKKAPISFKTRAEALHMCVEHSEHTQYPCMVQGCLSVV
KLESSIVRHYKRTHQMSSAYLEQQMENLVVCVKYGTKIKEEPPSEADPCIKKEENRSCES
ERTEHSHSPGDSSAPIQNTDCCHSSERDGGQKGCIESSSVFDADTLLYRGTLKCNHSSKT
TSLEQCNIVQPPPPCKIENSIPNPNGTESGTYFTSFQLPLPRIKESETRQHSSGQENTVK
NPTHVPKENFRKHSQPRSFDLKTYKPMGFESSFLKFIQESEEKEDDFDDWEPSEHLTLSN
SSQSSNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENL
RVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGSS
NT seq 5745 nt   +upstreamnt  +downstreamnt
atggcggacggaaagggagacgccgccgctgtcgccggggctggggctgaggctccggcg
gtagcgggagccggagatggagtcgagactgagtccatggttcggggtcatcgccccgta
tctccagcgccgggagcctcgggactgcggccgtgtctgtggcagctggagacagagctg
agggagcaagaggtgtcggaggtctcatctttgaactactgccggagcttctgccagacc
ttattgcaatatgcaagcaacaagaatgcatcagaacatattgtgtatcttctggaggta
tatcgacttgccatccaaagctttgccagtgcacgtccatacttaactactgaatgtgaa
gatgtcctcttagtgcttggcagattagtactgagttgtttcgaattactgctttcagtg
tctgaaagtgaactgccatgtgaagtctggctaccattccttcagtctctacaggagtca
catgatgcattattggaatttgggaataataacctacaaatattggttcatgttaccaag
gaaggggtgtggaaaaacccagttcttcttaaaattctgtctcaacagccagtagaaacg
gaggaagtcaataaattgattgcacaagaaggaccttcctttctgcaaatgcgaataaaa
catttgttgaaatctaactgcatcccccaggctactgctttatcaaaactatgtgcagaa
tctaaagaaatttcaaatgtgtcatcttttcagcaagcctatatcacatgtttatgttct
atgctccctaatgaagatgctattaaggagattgcaaaggtcgactgcaaggaagtacta
gacatcatttgtaatctggaatctgaggggcaggataacacagcatttgttctttgtacg
acttaccttacccagcagctccaaactgcaagtgtatattgttcttgggaactgactctt
ttttggagtaaactgcaaagaagaattgacccttctttagatacttttttggagcgctgt
cgtcagtttggtgtcatagctaaaacgcagcagcatttattttgcctcattagagttata
caaactgaagcacaagatgctggtcttggggtgtcaattttactgtgtgtcagagctctt
caactcagatcaagtgaagatgaggaaatgaaggcatcagtttgtaaaacaattgcctgt
cttttaccagaagatttagaagttagacgagcctgtcagcttacagaattcttaattgaa
cccagtttggatggatttaatatgttagaagaactatatttgcaaccagatcaaaaattt
gatgaagaaaatgcaccggttccaaattctcttcgatgtgagctcttactagctttaaaa
gcccactggccttttgatcctgagttttgggactggaaaactttaaaacgacactgccac
caacttttaggacaagaagcctcagattctgatgatgatttaagtggctatgaaatgtcc
attaatgacacagatgttttagagtcatttctcagtgactatgatgagggtaaagaagat
aaacaatatagaagaagagatttgacagatcagcataaggagaaaagagacaaaaaacct
attggctcttctgaaagatatcagaggtggcttcagtacaagtttttctgtttgttatgt
aagcgggaatgtatagaggctagaattcttcatcattctaagatgcatatggaagatgga
atttacacctgtccagtttgtattaaaaaatttaagagaaaagaaatgtttgttcctcat
gtgatggagcatgttaaaatgccaccaagcagaagggaccgctctaaaaagaaattactg
ttaaaaggctctcaaaagggtatttgtcctaagagcccctctgcaatcccagagcaaaac
cattcattgaatgaccaagccaaaggagagtctcatgaatatgtcacattcagcaaatta
gaagattgccacctgcaagacagagatttgtatccatgtcccggtacagactgttcccgt
gtgtttaagcaatttaaatacttaagtgtgcatcttaaagctgaacaccaaaataatgat
gaaaatgccaagcactacttggatatgaaaaatagaagagagaagtgtacttactgtcga
cgacattttatgtctgcttttcaccttcgagagcacgaacaagtgcattgtgggcctcag
ccttatatgtgtgtatctatagattgctatgctaggtttggatcagtaaatgaactactt
aaccataaacaaaagcatgacgatctgcgttacaaatgtgaattaaatggctgtaatatt
gttttcagtgacttgggacagctttaccaccatgaagcacaacactttagggatgcatct
tacacatgcaacttccttggctgtaaaaagttctattactccaaaattgaataccagaat
cacctctcaatgcataatgttgaaaattcaaatggagacataaagaaatcagtgaaactt
gaggagtctgcaacaggtgaaaagcaagattgtattaatcagccccatctacttaaccaa
actgataaatcacatttacctgaagatcttttctgtgcagaatcagctaattctcaaata
gatacagaaactgcagaaaacctgaaagaaaacagtgacagtaattctagtgatcagtta
agtcatagctcttcagcttcaatgaatgaagagctaattgacacactagatcactctgaa
actatgcaggatgtattgttatctaatgagaaagtctttgggccctccagtttaaaagaa
aaatgttccagtatggcagtttgttttgacgggactaagtttacctgtggttttgatggc
tgtggttccacatacaaaaatgcaagaggaatgcagaaacatttacggaaggttcatcca
taccatttcaagcccaaaaagataaagacgaaagatctgtttccctctttgggtaatgaa
cataatcagacaactgaaaagttggatgcagaacctaaaccctgctcagatacaaacagt
gactccccagatgaaggtctagatcacaatattcacattaaatgtaaacgagaacatcaa
ggttattcctcagaatcctccatttgtgcttctaaaaggccctgtacagaggataccatg
ttggaacttctgttacgcttgaaacatttaagcttgaaaaactcaataacacatggatct
ttctcagggtcattgcaggggtacccatccagtggtgctaagtctcttcagtcagtttca
tctatctcagaccttaattttcagaatcaagatgaaaacatgccaagtcagtaccttgca
cagttggcggctaagccgtttttctgtgagcttcaaggatgcaaatatgaatttgtgacc
agagaggctctgttaatgcattatcttaaaaagcataattattcaaaagaaaaagtcctt
cagttaaccatgttccaacatcggtattccccatttcagtgtcatatttgccaaaggtca
tttacaagaaaaacacaccttaggattcattataaaaataaacatcaaattggcagtgac
agagcaactcacaaactattagataatgaaaagtgtgatcatgaaggcccatgttcagta
gataggttgaaaggtgattgttctgcagaacttggaggtgatcccagtagtaactctgag
aaaccacactgtcatcctaaaaaggatgaatgtagttctgaaacagatttggaatcatct
tgtgaagaaacagaaagtaaaacatctgacatttcatcaccaataggcagccatagagaa
gaacaagaaggaagagagggcagaggtagcaggcgaactgttgctaaaggaaatctgtgt
tatattttgaataaataccacaaaccattccattgtattcataaaacttgcaactcctca
ttcaccaatctaaaaggcttaattcgccattacagaactgtacatcagtacaacaaagaa
cagttatgtttggagaaagacaaagcaagaaccaaaagggaacttgtcaaatgtaaaaag
atatttgcttgcaaatataaggaatgtaataaacgcttcctgtgttccaaagctcttgct
aagcactgtagtgattctcataacctagaccatattgaagagcctaaagtactttccgaa
gctggatctgcagcaaggttttcttgtaaccagcctcagtgccctgctgttttttataca
ttcaacaagttgaagcaccacttgatggaacagcataatattgaaggggaaatacattca
gattatgaaattcattgtgatcttaatggctgtggccagattttcacccatcgcagtaat
tactcacaacatgtatattaccgacataaagactattatgatgatttgtttagaagccag
aaagtagcaaatgagagactactaaggagtgaaaaggtatgtcaaacagctgatactcag
gggcatgaacatcagaccaccaggagatcatttaatgctaagtctaaaaaatgtggctta
atcaaagaaaagaaagccccaataagttttaaaaccagagctgaggccctccatatgtgt
gtggagcactctgagcacacacagtacccctgcatggttcaaggatgcttatctgtggtg
aagttggagagcagcattgtgaggcattacaaacgcactcatcagatgagtagtgcctat
ttagagcaacagatggagaatcttgttgtttgcgttaagtacggtaccaaaattaaggag
gaacccccttctgaagcagatccctgtataaagaaagaagaaaatagaagctgtgaatca
gagcgcacagaacacagccattccccgggtgacagtagtgcacccatccagaacactgat
tgctgtcattcaagtgaaagggatggaggtcagaaagggtgcatagaaagcagctcagta
tttgatgcagatactctgctctacaggggaactttgaaatgtaatcatagttccaaaacc
acttccctagaacagtgtaatatagttcagcctcctcctccttgtaaaatagaaaattcc
atacctaatcccaatgggactgaaagtgggacttatttcacaagtttccagctgccttta
ccaaggatcaaagaatcagaaactaggcagcatagttcagggcaagaaaacactgtaaaa
aatccaacccatgtcccaaaagagaattttaggaaacattcacagccccggtcatttgat
ttgaagacttacaaacctatgggatttgaatcttcatttctgaaatttattcaggaaagt
gaagagaaagaagatgattttgatgattgggagccttcagagcacttaacattaagtaat
tcttcacagtccagtaatgatttaacagggaatgttgtggcaaataatatggtgaatgac
agtgaacctgaagttgacatacctcattcttccagtgactctacaattcatgagaacctg
actgcaatcccacctttaatagtagctgaaacaacaacagttccttccttggaaaacctg
agggttgtattggacaaagcattaacagactgtggagagcttgccttaaaacagcttcat
tatcttcggccagtggtggttcttgaaagatctaagttttccacaccaattttagactta
tttccaacaaaaaagacagatgagctttgtgtaggaagttcataa

DBGET integrated database retrieval system