KEGG   Homo sapiens (human): 6019
Entry
6019              CDS       T01001                                 

Gene name
RLN2, H2, H2-RLX, RLXH2, bA12D24.1.1, bA12D24.1.2
Definition
(RefSeq) relaxin 2
  KO
K21998  relaxin 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6019 (RLN2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    6019 (RLN2)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 6019
NCBI-ProteinID: NP_604390
OMIM: 179740
HGNC: 10027
Ensembl: ENSG00000107014
Vega: OTTHUMG00000019496
Pharos: P04090(Tbio)
CPD: C16122
UniProt: P04090
Structure
PDB: 
6RLX 2MV1

Position
9p24.1
AA seq 185 aa
MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQE
DAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLK
DSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRS
LARFC
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcctcgcctgttttttttccacctgctaggagtctgtttactactgaaccaattttcc
agagcagtcgcggactcatggatggaggaagttattaaattatgcggccgcgaattagtt
cgcgcgcagattgccatttgcggcatgagcacctggagcaaaaggtctctgagccaggaa
gatgctcctcagacacctagaccagtggcagaaattgtgccatccttcatcaacaaagat
acagaaaccataaatatgatgtcagaatttgttgctaatttgccacaggagctgaagtta
accctgtctgagatgcagccagcattaccacagctacaacaacatgtacctgtattaaaa
gattccagtcttctctttgaagaatttaagaaacttattcgcaatagacaaagtgaagcc
gcagacagcagtccttcagaattaaaatacttaggcttggatactcattctcgaaaaaag
agacaactctacagtgcattggctaataaatgttgccatgttggttgtaccaaaagatct
cttgctagattttgctga

DBGET integrated database retrieval system