KEGG   Homo sapiens (human): 60313Help
Entry
60313             CDS       T01001                                 

Gene name
GPBP1L1, SP192
Definition
(RefSeq) GC-rich promoter binding protein 1 like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Vasculin
Motif
Other DBs
NCBI-GeneID: 60313
NCBI-ProteinID: NP_067652
HGNC: 28843
Ensembl: ENSG00000159592
Vega: OTTHUMG00000040990
Pharos: Q9HC44(Tdark)
UniProt: Q9HC44
Position
1p34.1
AA seq 474 aa AA seqDB search
MAQHDFVPAWLNFSTPQSAKSPTATFEKHGEHLPRGEGRFGVSRRRHNSSDGFFNNGPLR
TAGDSWHQPSLFRHDSVDSGVSKGAYAGITGNPSGWHSSSRGHDGMSQRSGGGTGNHRHW
NGSFHSRKGCAFQEKPPMEIREEKKEDKVEKLQFEEEDFPSLNPEAGKQHQPCRPIGTPS
GVWENPPSAKQPSKMLVIKKVSKEDPAAAFSAAFTSPGSHHANGNKLSSVVPSVYKNLVP
KPVPPPSKPNAWKANRMEHKSGSLSSSRESAFTSPISVTKPVVLASGAALSSPKESPSST
TPPIEISSSRLTKLTRRTTDRKSEFLKTLKDDRNGDFSENRDCDKLEDLEDNSTPEPKEN
GEEGCHQNGLALPVVEEGEVLSHSLEAEHRLLKAMGWQEYPENDENCLPLTEDELKEFHM
KTEQLRRNGFGKNGFLQSRSSSLFSPWRSTCKAEFEDSDTETSSSETSDDDAWK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcatgattttgttcctgcttggctaaatttctcaacaccacagtcagctaag
tcacctactgccaccttcgaaaaacacggagagcacctacccagaggagaaggtagattt
ggagtaagccgccgtcgacataattcctctgatggtttttttaacaatggtcccctacga
actgcaggagattcttggcaccagccctccctgttccgccatgattctgtggactctggt
gtctctaagggagcatatgctggaatcacagggaacccatctggttggcatagctcttcc
cgaggtcatgatggcatgagccaacgtagtggaggtggcacagggaaccatcgccattgg
aatggcagcttccactcccggaaagggtgtgcttttcaggaaaagccacctatggagatt
agggaagaaaagaaagaagacaaggtggaaaagttgcagtttgaagaggaggactttcct
tccttgaatccagaagctggcaaacagcatcagccatgcagacctattgggacaccttct
ggagtatgggaaaacccgcctagtgccaagcaaccctccaagatgctagttatcaaaaaa
gtttccaaagaggatcctgctgctgccttctctgctgcattcacctcaccaggatctcac
catgcaaatgggaacaaattgtcatccgtggttccaagtgtctataagaacctggttcct
aagcctgtaccacctccttccaagcctaatgcatggaaagctaacaggatggagcacaag
tcaggatccctttcctctagccgggagtctgcttttaccagtccaatctctgttaccaaa
ccagtggtactggctagtggtgcagctctgagttctcccaaagagagtccctccagcacc
acccctccaattgagatcagctcctctcgtctgaccaagttgacccgccgaaccaccgac
aggaagagtgagttcctgaaaactctgaaggatgaccggaatggagacttctcagagaat
agagactgtgacaagctggaagatttggaggacaacagcacacctgaaccaaaggaaaat
ggggaggaaggctgtcatcaaaatggtcttgccctccctgtagtggaagaaggggaggtt
ctctcacactctctagaagcagagcacaggttattgaaagctatgggttggcaggaatat
cctgaaaatgatgagaattgccttcccctcacagaggatgagctcaaagagttccacatg
aagacagagcagctgagaagaaatggctttggaaagaatggcttcttgcagagccgcagt
tccagtctgttctccccttggagaagcacttgcaaagcagagtttgaggactcagacacc
gaaaccagtagcagtgaaacatcagatgacgatgcctggaagtag

DBGET integrated database retrieval system