KEGG   Homo sapiens (human): 6035Help
Entry
6035              CDS       T01001                                 

Gene name
RNASE1, RAC1, RIB1, RNS1
Definition
(RefSeq) ribonuclease A family member 1, pancreatic
  KO
K01168  pancreatic ribonuclease [EC:3.1.27.5]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     6035 (RNASE1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     6035 (RNASE1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    6035 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA Mesothelin Conotoxin
Motif
Other DBs
NCBI-GeneID: 6035
NCBI-ProteinID: NP_002924
OMIM: 180440
HGNC: 10044
Ensembl: ENSG00000129538
Vega: OTTHUMG00000029603
Pharos: P07998(Tchem)
UniProt: P07998 W0UV93
Structure
PDB: 

Position
14q11.2
AA seq 156 aa AA seqDB search
MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggctctggagaagtctcttgtccggctccttctgcttgtcctgatactgctggtgctg
ggctgggtccagccttccctgggcaaggaatcccgggccaagaaattccagcggcagcat
atggactcagacagttcccccagcagcagctccacctactgtaaccaaatgatgaggcgc
cggaatatgacacaggggcggtgcaaaccagtgaacacctttgtgcacgagcccctggta
gatgtccagaatgtctgtttccaggaaaaggtcacctgcaagaacgggcagggcaactgc
tacaagagcaactccagcatgcacatcacagactgccgcctgacaaacggctccaggtac
cccaactgtgcataccggaccagcccgaaggagagacacatcattgtggcctgtgaaggg
agcccatatgtgccagtccactttgatgcttctgtggaggactctacctaa

DBGET integrated database retrieval system