KEGG   Homo sapiens (human): 6037
Entry
6037              CDS       T01001                                 

Gene name
RNASE3, ECP, RAF1, RNS3
Definition
(RefSeq) ribonuclease A family member 3
  KO
K10787  eosinophil cationic protein [EC:3.1.27.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05310  Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    6037 (RNASE3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6037 (RNASE3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     6037 (RNASE3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   Other degradation factors
    RNases
     6037 (RNASE3)
SSDB
Motif
Pfam: RnaseA
Other DBs
NCBI-GeneID: 6037
NCBI-ProteinID: NP_002926
OMIM: 131398
HGNC: 10046
Ensembl: ENSG00000169397
Vega: OTTHUMG00000029604
Pharos: P12724(Tbio)
UniProt: P12724
Structure
PDB: 

Position
14q11.2
AA seq 160 aa
MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI
SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI
NT seq 483 nt   +upstreamnt  +downstreamnt
atggttccaaaactgttcacttcccaaatttgtctgcttcttctgttggggcttatgggt
gtggagggctcactccatgccagacccccacagtttacgagggctcagtggtttgccatc
cagcacatcagtctgaacccccctcgatgcaccattgcaatgcgggcaattaacaattat
cgatggcgttgcaaaaaccaaaatacttttcttcgtacaacttttgctaatgtagttaat
gtttgtggtaaccaaagtatacgctgccctcataacagaactctcaacaattgtcatcgg
agtagattccgggtgcctttactccactgtgacctcataaatccaggtgcacagaatatt
tcaaactgcacgtatgcagacagaccaggaaggaggttctatgtagttgcatgtgacaac
agagatccacgggattctccacggtatcctgtggttccagttcacctggataccaccatc
taa

DBGET integrated database retrieval system