KEGG   Homo sapiens (human): 6038
Entry
6038              CDS       T01001                                 

Gene name
RNASE4, RAB1, RNS4
Definition
(RefSeq) ribonuclease A family member 4
  KO
K16632  ribonuclease 4 [EC:3.1.27.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6038 (RNASE4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     6038 (RNASE4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   Other degradation factors
    RNases
     6038 (RNASE4)
SSDB
Motif
Pfam: RnaseA
Other DBs
NCBI-GeneID: 6038
NCBI-ProteinID: NP_001269121
OMIM: 601030
HGNC: 10047
Ensembl: ENSG00000258818
Vega: OTTHUMG00000029575
Pharos: P34096(Tbio)
UniProt: P34096 Q53XB4
Structure
PDB: 
1RNF 2RNF

Position
14q11.2
AA seq 147 aa
MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRR
KMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNC
RYRAIASTRRVVIACEGNPQVPVHFDG
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctctgcagaggacccattcattgcttctgcttttgctgctgaccctgctggggctg
gggctggtccagccctcctatggccaggatggcatgtaccagcgattcctgcggcaacac
gtgcaccctgaggagacaggtggcagtgatcgctactgcaacttgatgatgcaaagacgg
aagatgactttgtatcactgcaagcgcttcaacaccttcatccatgaagatatctggaac
attcgtagtatctgcagcaccaccaatatccaatgcaagaacggcaagatgaactgccat
gagggtgtagtgaaggtcacagattgcagggacacaggaagttccagggcacccaactgc
agatatcgggccatagcgagcactagacgtgttgtcattgcctgtgagggtaacccacag
gtgcctgtgcactttgacggttag

DBGET integrated database retrieval system