KEGG   Homo sapiens (human): 60385
Entry
60385             CDS       T01001                                 

Gene name
TSKS, PPP1R161, STK22S1, TSKS1, TSSKS
Definition
(RefSeq) testis specific serine kinase substrate
  KO
K16492  testis-specific serine kinase substrate
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    60385 (TSKS)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    60385 (TSKS)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     60385 (TSKS)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    60385 (TSKS)
SSDB
Motif
Pfam: TSKS AAA_13 Laminin_II DUF4407 Tropomyosin
Other DBs
NCBI-GeneID: 60385
NCBI-ProteinID: NP_068379
OMIM: 608253
HGNC: 30719
Ensembl: ENSG00000126467
Vega: OTTHUMG00000183249
Pharos: Q9UJT2(Tbio)
UniProt: Q9UJT2
Position
19q13.33
AA seq 592 aa
MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKKKAVSFHGVEP
QMSHQPMHWCLNLKRSSACTNVSLLNLAAMEPTDSTGTDSTVEDLSGQLTLAGPPASPTL
PWDPDDADITEILSGVNSGLVRAKDSITSLKEKTNRVNQHVQSLQSECSVLSENLERRRQ
EAEELEGYCIQLKENCWKVTRSVEDAEIKTNVLKQNSALLEEKLRYLQQQLQDETPRRQE
AELQEPEEKQEPEEKQEPEEKQKPEAGLSWNSLGPAATSQGCPGPPGSPDKPSRPHGLVP
AGWGMGPRAGEGPYVSEQELQKLFTGIEELRREVSSLTARWHQEEGAVQEALRLLGGLGG
RVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPI
LEEFGRQFQNSRRGPDLSMNLDRSHQGNCARCASQGSQLSTESLQQLLDRALTSLVDEVK
QRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKP
EEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggcgagcgtggtggtgaagacgatctggcagtccaaagagatccatgaggccggggac
acccccacgggggtggagagctgctcccagctagtcccagaggctccccggagggtgacc
agccgggccaaggggatcccgaagaaaaagaaggccgtgtcgttccacggggtggagccc
cagatgtcccatcagcccatgcactggtgcctgaacctcaaacggtcctcggcctgcacc
aacgtgtcactgctcaacctggccgccatggagcccactgactccacggggacagactcc
acagtggaagacctcagcggccaactcacactggctgggccccctgcctcccctacccta
ccctgggatccggatgacgcagacatcacggaaatcctgagtggggtcaacagtggattg
gtccgcgccaaagactccatcaccagcttgaaggaaaagaccaaccgggttaaccagcac
gtgcagtctctgcagagcgagtgttctgtgctgagcgagaatctggagagaaggcggcaa
gaggcagaagagttggaggggtactgcattcaactcaaggagaactgctggaaggtgacc
cggtctgtggaagatgctgaaatcaaaaccaacgtcttgaagcagaattctgccctgctg
gaggagaagctgcgctacctccagcagcagctgcaggatgagacgccgcgacggcaggag
gccgagctgcaggagccggaggagaagcaggagccggaggagaagcaggagccggaggag
aagcagaagccggaggctggcctctcctggaacagcctgggccccgccgccacgtcccag
ggctgccccggcccgccagggagtcccgacaaaccctcgcggccacacggcctggtcccc
gcaggctggggaatggggcctcgggctggcgagggcccctacgtgagcgagcaggaattg
cagaagctgttcaccggcatcgaagagctgaggagagaggtgtcctcactgaccgcccgg
tggcatcaggaggagggggcggtgcaggaagccctgcggctgctcgggggcctgggcggc
agggtcgacggcttcctaggccagtgggagcgggcacagcgcgaacaggcacagacggcg
cgggacttgcaggagctgcgaggtcgggcggatgagctgtgcaccatggtggagcggtca
gcagtgtctgtggcttcactgaggagcgaactggaggggctgggcccactgaaacccatt
ctggaggagttcgggcggcaatttcagaactctcgaagagggcctgacctctccatgaac
ctggatcggtcccaccaaggcaactgtgcccgctgtgccagccaggggtcgcagttgtct
acggagtccctgcagcagctgctggaccgagcactgacctcactagtggacgaggtgaag
cagaggggcctgactcctgcctgtcccagctgtcagaggctacacaagaagattctggag
ctggagcgccaggccttagccaaacacgtcagggcagaggccctgagctccacccttcgg
ctggcccaagacgaggccctgcgggccaagaacctactgctgacagacaagatgaagcca
gaggagaagatggccactctggaccatctacacttgaagatgtgctccctccacgatcat
ctcagcaacctgccacttgaggggtccacgggaacaatggggggaggcagcagtgcagga
acccccccaaaacaggggggctcagcccctgaacaataa

DBGET integrated database retrieval system