KEGG   Homo sapiens (human): 604Help
Entry
604               CDS       T01001                                 

Gene name
BCL6, BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
Definition
(RefSeq) B cell CLL/lymphoma 6
  KO
K15618  B-cell lymphoma 6 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00006  Hairy-cell leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    604 (BCL6)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    604 (BCL6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    604 (BCL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-met zf-C2H2_4 zf-C2H2_jaz DZR zf-C2H2_6 zf-C2HE Zn-ribbon_8 DUF3342
Motif
Other DBs
NCBI-GeneID: 604
NCBI-ProteinID: NP_001124317
OMIM: 109565
HGNC: 1001
Ensembl: ENSG00000113916
Vega: OTTHUMG00000156441
Pharos: P41182(Tbio)
UniProt: P41182
Structure
PDB: 

Position
3q27.3
AA seq 706 aa AA seqDB search
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAF
APSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPG
EYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGS
QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgccggctgacagctgtatccagttcacccgccatgccagtgatgttcttctc
aaccttaatcgtctccggagtcgagacatcttgactgatgttgtcattgttgtgagccgt
gagcagtttagagcccataaaacggtcctcatggcctgcagtggcctgttctatagcatc
tttacagaccagttgaaatgcaaccttagtgtgatcaatctagatcctgagatcaaccct
gagggattctgcatcctcctggacttcatgtacacatctcggctcaatttgcgggagggc
aacatcatggctgtgatggccacggctatgtacctgcagatggagcatgttgtggacact
tgccggaagtttattaaggccagtgaagcagagatggtttctgccatcaagcctcctcgt
gaagagttcctcaacagccggatgctgatgccccaagacatcatggcctatcggggtcgt
gaggtggtggagaacaacctgccactgaggagcgcccctgggtgtgagagcagagccttt
gcccccagcctgtacagtggcctgtccacaccgccagcctcttattccatgtacagccac
ctccctgtcagcagcctcctcttctccgatgaggagtttcgggatgtccggatgcctgtg
gccaaccccttccccaaggagcgggcactcccatgtgatagtgccaggccagtccctggt
gagtacagccggccgactttggaggtgtcccccaatgtgtgccacagcaatatctattca
cccaaggaaacaatcccagaagaggcacgaagtgatatgcactacagtgtggctgagggc
ctcaaacctgctgccccctcagcccgaaatgccccctacttcccttgtgacaaggccagc
aaagaagaagagagaccctcctcggaagatgagattgccctgcatttcgagccccccaat
gcacccctgaaccggaagggtctggttagtccacagagcccccagaaatctgactgccag
cccaactcgcccacagagtcctgcagcagtaagaatgcctgcatcctccaggcttctggc
tcccctccagccaagagccccactgaccccaaagcctgcaactggaagaaatacaagttc
atcgtgctcaacagcctcaaccagaatgccaaaccagaggggcctgagcaggctgagctg
ggccgcctttccccacgagcctacacggccccacctgcctgccagccacccatggagcct
gagaaccttgacctccagtccccaaccaagctgagtgccagcggggaggactccaccatc
ccacaagccagccggctcaataacatcgttaacaggtccatgacgggctctccccgcagc
agcagcgagagccactcaccactctacatgcaccccccgaagtgcacgtcctgcggctct
cagtccccacagcatgcagagatgtgcctccacaccgctggccccacgttccctgaggag
atgggagagacccagtctgagtactcagattctagctgtgagaacggggccttcttctgc
aatgagtgtgactgccgcttctctgaggaggcctcactcaagaggcacacgctgcagacc
cacagtgacaaaccctacaagtgtgaccgctgccaggcctccttccgctacaagggcaac
ctcgccagccacaagaccgtccataccggtgagaaaccctatcgttgcaacatctgtggg
gcccagttcaaccggccagccaacctgaaaacccacactcgaattcactctggagagaag
ccctacaaatgcgaaacctgcggagccagatttgtacaggtggcccacctccgtgcccat
gtgcttatccacactggtgagaagccctatccctgtgaaatctgtggcacccgtttccgg
caccttcagactctgaagagccacctgcgaatccacacaggagagaaaccttaccattgt
gagaagtgtaacctgcatttccgtcacaaaagccagctgcgacttcacttgcgccagaag
catggcgccatcaccaacaccaaggtgcaataccgcgtgtcagccactgacctgcctccg
gagctccccaaagcctgctga

DBGET integrated database retrieval system