KEGG   Homo sapiens (human): 60468Help
Entry
60468             CDS       T01001                                 

Gene name
BACH2, BTBD25
Definition
(RefSeq) BTB domain and CNC homolog 2
  KO
K09042  transcription regulator BACH
Organism
hsa  Homo sapiens (human)
Disease
H00408  Type 1 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    60468 (BACH2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    60468 (BACH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB bZIP_Maf bZIP_1 bZIP_2 KASH_CCD DUF3342
Motif
Other DBs
NCBI-GeneID: 60468
NCBI-ProteinID: NP_001164265
OMIM: 605394
HGNC: 14078
Ensembl: ENSG00000112182
Vega: OTTHUMG00000015216
Pharos: Q9BYV9(Tbio)
UniProt: Q9BYV9
Structure
PDB: 

Position
6q15
AA seq 841 aa AA seqDB search
MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSE
YFWQALVGQTKNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHN
LEDSCFSFLQTQLLNSEDGLFVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMAC
PRDQMLPEPISFEAAAIPVAEKEEALLPEPDVPTDTKESSEKDALTQYPRYKKYQLACTK
NVYNASSHSTSGFASTFREDNSSNSLKPGLARGQIKSEPPSEENEEESITLCLSGDEPDA
KDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITKSVELSGLPSTS
QQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQKEVSNFTMGSPLRGPGLEALC
KQEGELDRRSVIFSSSACDQVSTSVHSYSGVSSLDKDLSEPVPKGLWVGAGQSLPSSQAY
SHGGLMADHLPGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSL
PLCEFSSSPCSQGARFLATEHQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEAD
SESCPVQDRGQEVKLPFPVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAA
QRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSP
EQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCLEPGAAPPGPP
WAPSNTSENCTSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY
T
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggatgagaagcctgactcccccatgtatgtgtatgagtccacagtccactgc
accaacatcctcctgggcctcaatgaccagcggaaaaaggatattctctgtgacgtgact
ttgatcgtggagaggaaggagttccgggcccaccgggctgtgctggccgcatgcagtgaa
tatttttggcaggcgctggttggacagacaaaaaatgatttggtggtcagcttgcctgag
gaggtcacagccaggggctttgggccgctgttacagtttgcctacactgccaagctgtta
ctcagcagagaaaacatccgcgaggtcatccgctgtgctgagttcctgcgcatgcacaac
ctggaggactcctgcttcagcttcctgcagacccagctcctgaacagtgaggatggcctg
tttgtgtgccggaaggatgctgcgtgccagcgcccacacgaggactgcgagaactctgca
ggagaggaggaggatgaagaggaggagacgatggattcagagacggccaagatggcttgc
cccagggaccagatgcttccagagcccatcagctttgaggccgccgccatccccgtagca
gagaaggaagaagccctgctgcccgagcctgacgtgcccacagacaccaaggagagctca
gaaaaggacgcgttaacgcagtaccccagatacaagaaataccagcttgcatgtaccaag
aatgtctataatgcatcatcacacagtacctcaggttttgcaagcacattccgggaagat
aactctagcaacagcctcaagccggggcttgccagggggcagattaaaagtgagccgccc
agtgaagagaatgaggaagagagcatcacgctctgcctgtctggagatgagcctgacgcc
aaggacagagcgggggatgtcgagatggaccggaaacagcccagccctgcccctaccccc
acggccccagctggggccgcctgcctggagagatccaggagcgtggcctcgccctcctgc
ttaaggtctctgttcagcataacgaaaagtgtggagctgtctggcctgcccagtacatct
cagcagcactttgccaggagtccagcctgcccttttgacaaggggatcactcagggtgac
cttaaaactgactacacccctttcacagggaattatggacagccccacgtgggccagaag
gaggtgtccaacttcaccatggggtcgcccctcagggggcctgggttggaggctctctgt
aaacaggagggagagctggaccggaggagcgtgatcttctcctccagcgcttgtgaccaa
gtgagcacctcggtgcattcttattctggggtgagcagtttggacaaagacctctctgag
ccggtgccaaagggtctgtgggtgggagccggccagtccctccccagctcgcaggcctac
tcccacggtgggctgatggccgaccacttgccaggaaggatgcggcccaacaccagctgc
ccggtaccaatcaaagtctgccctcgctcaccccccttggagaccaggaccaggacttcc
agctcctgctcttcctattcctacgcggaggacgggagcgggggctcaccctgcagcctc
cctctctgtgagttctcctcctcgccctgttcccagggagccagattccttgccacagaa
catcaggaaccaggcctgatgggagatggaatgtacaaccaagtgcggccccaaattaaa
tgtgagcagtcttatggaaccaactccagtgacgaatccggatcgttctcggaagcagac
agtgagtcgtgtcctgtgcaggacaggggccaggaggtaaaacttccttttcctgtagat
caaatcacagatcttccaaggaacgatttccagatgatgattaaaatgcacaagctaacc
tcagaacagttagagtttattcatgatgtccgacggcgcagcaagaaccgcatcgcggcc
cagcgctgccgcaaaaggaaactggactgtattcagaatttagaatgtgaaatccgcaaa
ttggtgtgtgagaaagagaaactgttgtcagagaggaatcaactgaaagcatgcatgggg
gaactgttggacaacttctcctgcctttcccaggaagtttgccgagacatccagagcccc
gagcagatccaggccctgcatcggtattgccctgtcctcagacccatggacttgcccacg
gcctccagtattaaccctgcgcccttgggtgctgagcagaacattgcggcctcccaatgc
gcagtgggggaaaacgtgccctgctgcttggagccaggcgcggctccccccggacccccc
tgggcacccagcaacacctccgagaattgtacctctgggaggagactagaaggcactgac
ccgggaaccttctcagagagaggacctcctcttgaacccaggagccaaacagtgaccgtg
gacttctgccaggaaatgactgataagtgtacaactgacgaacagcccaggaaagattat
acctag

DBGET integrated database retrieval system