KEGG   Homo sapiens (human): 60484
Entry
60484             CDS       T01001                                 
Symbol
HAPLN2, BRAL1
Name
(RefSeq) hyaluronan and proteoglycan link protein 2
  KO
K06851  hyaluronan and proteoglycan link protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    60484 (HAPLN2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   60484 (HAPLN2)
SSDB
Motif
Pfam: Xlink V-set Ig_3 I-set Ig_2 ig Izumo-Ig
Other DBs
NCBI-GeneID: 60484
NCBI-ProteinID: NP_068589
OMIM: 619726
HGNC: 17410
Ensembl: ENSG00000132702
Pharos: Q9GZV7(Tbio)
UniProt: Q9GZV7
Position
1:156601504..156625725
AA seq 340 aa
MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLG
TTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRL
EDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATY
SQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFC
FTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSV
RFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgccaggctggctcaccctccccacactctgccgcttccttctttgggccttcaccatc
ttccacaaagcccaaggagacccagcatcccacccgggcccccactacctcctgcccccc
atccacgaggtcattcactctcatcgtggggccacggccacgctgccctgcgtcctgggc
accacgcctcccagctacaaggtgcgctggagcaaggtggagcctggggagctccgggaa
acgctgatcctcatcaccaacggactgcacgcccgggggtatgggcccctgggagggcgc
gccaggatgcggagggggcatcgactagacgcctccctggtcatcgcgggcgtgcgcctg
gaggacgagggccggtaccgctgcgagctcatcaacggcatcgaggacgagagcgtggcg
ctgaccttgagcttggagggtgtggtgtttccgtaccaacccagccggggccggtaccag
ttcaattactacgaggcgaagcaggcgtgcgaggagcaggacggacgcctggccacctac
tcccagctctaccaggcttggaccgagggtctggactggtgtaacgcgggctggctgctc
gagggctccgtgcgctaccctgtgctcaccgcacgcgccccgtgcggcggccgaggccgg
cccgggatccgcagctacggaccccgcgaccggatgcgcgaccgctacgacgccttctgc
ttcacctccgcgctggcgggccaagtgttcttcgtgcccgggcggctgacgctgtctgaa
gcccacgcggcgtgccggcgacgcggcgccgtggtggccaaggttgggcacctctacgcc
gcctggaagttttcggggctagaccagtgcgacggcggctggctggctgacggcagtgtg
cgcttcccaatcaccacgccgaggccgcgctgcggggggctcccggatcccggagtgcgc
agtttcggcttccccaggccccaacaggcagcctatgggacctactgctacgccgagaat
tag

DBGET integrated database retrieval system