KEGG   Homo sapiens (human): 60490
Entry
60490             CDS       T01001                                 
Symbol
PPCDC, MDS018, PPC-DC, coaC
Name
(RefSeq) phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    60490 (PPCDC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     60490 (PPCDC)
SSDB
Motif
Pfam: Flavoprotein
Other DBs
NCBI-GeneID: 60490
NCBI-ProteinID: NP_068595
OMIM: 609854
HGNC: 28107
Ensembl: ENSG00000138621
Vega: OTTHUMG00000142824
Pharos: Q96CD2(Tbio)
UniProt: Q96CD2
Structure
Position
15:75023590..75050726
AA seq 204 aa
MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFY
SPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLL
TCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGA
MAEVGTIVDKVKEVLFQHSGFQQS
NT seq 615 nt   +upstreamnt  +downstreamnt
atggaaccaaaggcctcctgtccagctgctgcacccttgatggagagaaaattccatgtt
cttgtgggtgtcacggggagtgtcgcagccctgaagttgcctcttctggtgtcaaagctt
ttggacattcctgggctggaagtagcagtggtcacaactgagagagccaaacatttctac
agcccccaggacattcctgtcaccctctacagcgacgctgatgaatgggagatatggaag
agccgctctgacccagttctgcacattgacctgcggaggtgggcagacctcctgctggtg
gctcctcttgatgccaacactctggggaaggtggccagtggcatctgtgacaacttgctt
acctgcgtcatgcgggcctgggaccgcagcaagcccctgctcttctgcccggccatgaac
accgccatgtgggagcacccgatcacagcgcagcaggtagaccagctcaaggcctttggc
tatgtcgagatcccctgtgtggccaagaagctggtgtgcggagatgaaggtctcggggcc
atggctgaagtggggaccatcgtggacaaagtgaaagaagtcctcttccagcacagtggc
ttccagcagagttga

DBGET integrated database retrieval system