KEGG   Homo sapiens (human): 60491
Entry
60491             CDS       T01001                                 
Symbol
NIF3L1, ALS2CR1, CALS-7, MDS015
Name
(RefSeq) NGG1 interacting factor 3 like 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF34_NIF3 VID
Other DBs
NCBI-GeneID: 60491
NCBI-ProteinID: NP_001129511
OMIM: 605778
HGNC: 13390
Ensembl: ENSG00000196290
UniProt: Q9GZT8
Position
2:200889327..200903932
AA seq 377 aa
MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSP
PHTVNTLFLTNDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENR
VGIYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLD
KVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSL
EKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRLALGVGRTLESQVKVVALCAG
SGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDLRDMLDSHLEN
KINIILSETDRDPLQVV
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgttgtcatcttgcgtacgcccagtccccacgacagtccggtttgtagattccctgatc
tgcaattcttcccgttccttcatggatttgaaggctctcctttcttccttgaatgacttt
gcatccctctcgtttgctgagagttgggacaatgttggattactggtggaaccaagccca
ccacatactgtaaatacactcttcctgaccaatgacctgactgaggaagtgatggaggag
gtgctgcaaaagaaggcagacctcattctctcctaccatccgcctatcttccgacccatg
aagcgcataacctggaacacatggaaggagcgcctggtgatccgggctctggagaacaga
gtcggtatctactctcctcatacagcctatgatgctgcgccccagggcgtcaacaactgg
ttggctaaagggcttggagcttgtacctccaggcccatacatccttccaaagctcccaac
taccctacagagggaaaccaccgagtagaattcaacgttaactacacccaagacctggac
aaagtcatgtctgcagtgaaaggaattgacggtgtttctgtcacttctttttctgctagg
actggtaatgaggaacaaacacggattaatctgaattgtactcagaaggctttgatgcag
gtggtagattttctttcccggaacaaacaactttatcagaagacggaaattctgtcactg
gagaagcctttgcttctacatactggaatgggacggttatgcacactggatgaatctgtc
tccctggcaaccatgattgatcgaataaaaagacacctaaaactatctcatattcgctta
gcccttggggtggggagaaccttagagtctcaagtcaaagtcgtggccctgtgtgctggt
tctgggagcagcgttctgcagggtgttgaggctgacctttacctcacaggtgagatgtcc
catcatgatactttggatgctgcttcccaaggaataaatgtcatcctctgtgaacacagc
aacactgaacgaggctttctttctgaccttcgagatatgctggattctcacttggagaat
aagataaatattatcctatcagagactgacagggaccctcttcaggtggtataa

DBGET integrated database retrieval system