KEGG   Homo sapiens (human): 6051Help
Entry
6051              CDS       T01001                                 

Gene name
RNPEP, AP-B, APB
Definition
(RefSeq) arginyl aminopeptidase
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6051 (RNPEP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     6051 (RNPEP)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M1
   6051 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 6051
NCBI-ProteinID: NP_064601
OMIM: 602675
HGNC: 10078
Ensembl: ENSG00000176393
Vega: OTTHUMG00000035866
Pharos: Q9H4A4(Tchem)
UniProt: Q9H4A4
Position
1q32.1
AA seq 650 aa AA seqDB search
MASGEHSPGSGAARRPLHSAQAVDVASASNFRAFELLHLHLDLRAEFGPPGPGAGSRGLS
GTAVLDLRCLEPEGAAELRLDSHPCLEVTAAALRRERPGSEEPPAEPVSFYTQPFSHYGQ
ALCVSFPQPCRAAERLQVLLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFP
CFDTPAVKYKYSALIEVPDGFTAVMSASTWEKRGPNKFFFQMCQPIPSYLIALAIGDLVS
AEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGM
ENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRIST
ILFGAAYTCLEAATGRALLRQHMDITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCF
VSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYFPELKKKRVDIIPGFEFD
RWLNTPGWPPYLPDLSPGDSLMKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLD
KILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGK
QKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcggcgagcattcccccggcagcggcgcggcccggcggccgctgcactccgcg
caggctgtggacgtggcctcggcctccaacttccgggcctttgagctgctgcacttgcac
ctggacctgcgggctgagttcgggcctccagggcccggcgcagggagccgggggctgagc
ggcaccgcggtcctggacctgcgctgcctggagcccgagggcgccgccgagctgcggctg
gactcgcacccgtgcctggaggtgacggcggcggcgctgcggcgggagcggcccggctcg
gaggagccgcctgcggagcccgtgagcttctacacgcagcccttctcgcactatggccag
gccctgtgcgtgtccttcccgcagccctgccgcgccgccgagcgcctccaggtgctgctc
acctaccgcgtcggggagggacccggggtttgctggttggctcccgagcagacagcagga
aagaagaagcccttcgtgtacacccagggccaggctgtcctaaaccgggccttcttccct
tgcttcgacacgcctgctgttaaatacaagtattcagctcttattgaggtcccagatggc
ttcacagctgtgatgagtgctagcacctgggagaagagaggtccaaataagttcttcttc
cagatgtgtcagcccatcccctcctatctgatagctttggccatcggagatctggtttcg
gctgaagttggacccaggagccgggtgtgggctgagccctgcctgattgatgctgccaag
gaggagtacaacggggtgatagaagaatttttggcaacaggagagaagctttttggacct
tatgtttggggaaggtatgacttgctcttcatgccaccgtcctttccatttggaggaatg
gagaacccttgtctgacctttgtcaccccctgcctgctagctggggaccgctccttggca
gatgtcatcatccatgagatctcccacagttggtttgggaacctggtcaccaacgccaac
tggggtgaattctggctcaatgaaggtttcaccatgtacgcccagaggaggatctccacc
atcctctttggcgctgcgtacacctgcttggaggctgcaacggggcgggctctgctgcgt
cagcacatggacatcactggagaggaaaacccactcaacaagctccgcgtgaagattgaa
ccaggcgttgacccggacgacacctataatgagaccccctacgagaaaggtttctgcttt
gtttcatacctggcccacttggtgggtgatcaggatcagtttgacagttttctcaaggcc
tatgtgcatgaattcaaattccgaagcatcttagccgatgactttctggacttctacttg
gaatatttccctgagcttaagaaaaagagagtggatatcattccaggttttgagtttgat
cgatggctgaatacccccggctggcccccgtacctccctgatctctcccctggggactca
ctcatgaagcctgctgaagagctagcccaactgtgggcagccgaggagctggacatgaag
gccattgaagccgtggccatctctccctggaagacctaccagctggtctacttcctggat
aagatcctccagaaatcccctctccctcctgggaatgtgaaaaaacttggagacacatac
ccaagtatctcaaatgcccggaatgcagagctccggctgcgatggggccaaatcgtcctt
aagaacgaccaccaggaagatttctggaaagtgaaggagttcctgcataaccaggggaag
cagaagtatacacttccgctgtaccacgcaatgatgggtggcagtgaggtggcccagacc
ctcgccaaggagacttttgcatccaccgcctcccagctccacagcaatgttgtcaactat
gtccagcagatcgtggcacccaagggcagttag

DBGET integrated database retrieval system