KEGG   Homo sapiens (human): 60559Help
Entry
60559             CDS       T01001                                 

Gene name
SPCS3, PRO3567, SPC22/23, SPC3, YLR066W
Definition
(RefSeq) signal peptidase complex subunit 3
  KO
K12948  signal peptidase complex subunit 3 [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    60559 (SPCS3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     60559 (SPCS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPC22 CBM_3
Motif
Other DBs
NCBI-GeneID: 60559
NCBI-ProteinID: NP_068747
HGNC: 26212
Ensembl: ENSG00000129128
Vega: OTTHUMG00000160789
Pharos: P61009(Tdark)
UniProt: P61009
Position
4q34.2
AA seq 180 aa AA seqDB search
MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRER
SDLGFITFDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLL
KDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHVSVPFPDTYEITKSY
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggtgctgtcgcgggcgaactcactgttcgccttctcgctgagcgtgatggcg
gcgctcaccttcggctgcttcatcaccaccgccttcaaagacaggagcgtcccggtgcgg
ctgcacgtctcgcggatcatgctaaaaaatgtagaagatttcactggacctagagaaaga
agtgatctgggatttatcacatttgatataactgctgatctagagaatatatttgattgg
aatgttaagcagttgtttctttatttatcagcagaatattcaacaaaaaataatgctctg
aaccaagttgtcctatgggacaagattgttttgagaggtgataatccgaagctgctgctg
aaagatatgaaaacaaaatattttttctttgacgatggaaatggtctcaagggaaacagg
aatgtcactttgaccctgtcttggaacgtcgtaccaaatgctggaattctacctcttgtg
acaggatcaggacacgtatctgtcccatttccagatacatatgaaataacgaagagttat
taa

DBGET integrated database retrieval system