KEGG   Homo sapiens (human): 6059Help
Entry
6059              CDS       T01001                                 

Gene name
ABCE1, ABC38, OABP, RLI, RLI1, RNASEL1, RNASELI, RNS4I
Definition
(RefSeq) ATP binding cassette subfamily E member 1
  KO
K06174  ATP-binding cassette, sub-family E, member 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    6059 (ABCE1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    6059 (ABCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran RLI AAA_21 SMC_N Fer4 AAA_16 AAA_15 AAA RsgA_GTPase Fer4_6 AAA_22 AAA_29 NACHT Fer4_7 Rad17 SRP54 AAA_30 AAA_24 AAA_33 Fer4_2 Fer4_21 Fer4_10 TsaE Fer4_16 AAA_23 AAA_7 Fer4_17 Fer4_9
Motif
Other DBs
NCBI-GeneID: 6059
NCBI-ProteinID: NP_001035809
OMIM: 601213
HGNC: 69
Ensembl: ENSG00000164163
Vega: OTTHUMG00000161478
Pharos: P61221(Tbio)
UniProt: P61221
Position
4q31.21
AA seq 599 aa AA seqDB search
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGI
CIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTAL
KILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAA
KGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMF
DEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT
MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEF
ELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPA
DVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPS
KNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaagttaacgagaattgctattgtcaaccatgacaaatgtaaacctaagaaa
tgtcgacaggaatgcaaaaagagttgtcctgtagttcgaatgggaaaattatgcatagag
gttacaccccagagcaaaatagcatggatttccgaaactctttgtattggttgtggtatc
tgtattaagaaatgcccctttggcgccttatcaattgtcaatctaccaagcaacttggaa
aaagaaaccacacatcgatattgtgccaatgccttcaaacttcacaggttgcctatccct
cgtccaggtgaagttttgggattagttggaactaatggtattggaaagtcaactgcttta
aaaattttagcaggaaaacaaaagccaaaccttggaaagtacgatgatcctcctgactgg
caggagattttgacttatttccgtggatctgaattacaaaattactttacaaagattcta
gaagatgacctaaaagccatcatcaaacctcaatatgtagaccagattcctaaggctgca
aaggggacagtgggatctattttggaccgaaaagatgaaacaaagacacaggcaattgta
tgtcagcagcttgatttaacccacctaaaagaacgaaatgttgaagatctttcaggagga
gagttgcagagatttgcttgtgctgtcgtttgcatacagaaagctgatattttcatgttt
gatgagccttctagttacctagatgtcaagcagcgtttaaaggctgctattactatacga
tctctaataaatccagatagatatatcattgtggtggaacatgatctaagtgtattagac
tatctctccgacttcatctgctgtttatatggtgtaccaagcgcctatggagttgtcact
atgccttttagtgtaagagaaggcataaacatttttttggatggctatgttccaacagaa
aacttgagattcagagatgcatcacttgtttttaaagtggctgagacagcaaatgaagaa
gaagttaaaaagatgtgtatgtataaatatccaggaatgaagaaaaaaatgggagaattt
gagctagcaattgtagctggagagtttacagattctgaaattatggtgatgctgggggaa
aatggaacgggtaaaacgacatttatcagaatgcttgctggaagacttaaacctgatgaa
ggaggagaagtaccagttctaaatgtcagttataagccacagaaaattagtcccaaatca
actggaagtgttcgccagttactacatgaaaagataagagatgcttatactcacccacaa
tttgtgaccgatgtaatgaagcctctgcaaattgaaaacatcattgatcaagaggtgcag
acattatctggtggtgaactacagcgagtagctttagccctttgcttgggcaaacctgct
gatgtctatttaattgatgaaccatctgcatatttggattctgagcaaagactgatggca
gctcgagttgtcaaacgtttcatactccatgcaaaaaagacagcctttgttgtggaacat
gacttcatcatggccacctatctagcggatcgcgtcatcgtttttgatggtgttccatct
aagaacacagttgcaaacagtcctcaaacccttttggctggcatgaataaatttttgtct
cagcttgaaattacattcagaagagatccaaacaactataggccacgaataaacaaactt
aattcaattaaggatgtagaacaaaagaagagtggaaactactttttcttggatgattag

DBGET integrated database retrieval system