KEGG   Homo sapiens (human): 60673Help
Entry
60673             CDS       T01001                                 

Gene name
ATG101, C12orf44
Definition
(RefSeq) autophagy related 101
  KO
K19730  autophagy-related protein 101
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
hsa05017  Spinocerebellar ataxia
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    60673 (ATG101)
   04136 Autophagy - other
    60673 (ATG101)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    60673 (ATG101)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    60673 (ATG101)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    60673 (ATG101)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    60673 (ATG101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG101
Motif
Other DBs
NCBI-GeneID: 60673
NCBI-ProteinID: NP_001092143
OMIM: 615089
HGNC: 25679
Ensembl: ENSG00000123395
Vega: OTTHUMG00000169611
Pharos: Q9BSB4(Tbio)
UniProt: Q9BSB4 A0A024R128
Structure
PDB: 

Position
12q13.13
AA seq 218 aa AA seqDB search
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtcgctcggaggtgctggaggtgtcggtggaggggcggcaggtggaggaggcc
atgctggctgtgctgcacacggtgcttctgcaccgcagcacaggcaagttccactacaag
aaggagggcacctactccattggcaccgtgggcacccaggatgttgactgtgacttcatc
gacttcacttatgtgcgtgtctcttctgaggaactggatcgtgccctgcgcaaggttgtt
ggggagttcaaggatgcactgcgcaactctggtggcgatgggctggggcagatgtccttg
gagttctaccagaagaagaagtctcgctggccattctcagacgagtgcatcccatgggaa
gtgtggacggtcaaggtgcatgtggtagccctggccacggagcaggagcggcagatctgc
cgggagaaggtgggtgagaaactctgcgagaagatcatcaacatcgtggaggtgatgaat
cggcatgagtacttgcccaagatgcccacacagtcggaggtggataacgtgtttgacaca
ggcttgcgggacgtgcagccctacctgtacaagatctccttccagatcactgatgccctg
ggcacctcagtcaccaccaccatgcgcaggctcatcaaagacacccttgccctctga

DBGET integrated database retrieval system