KEGG   Homo sapiens (human): 60673Help
Entry
60673             CDS       T01001                                 

Gene name
ATG101, C12orf44
Definition
(RefSeq) autophagy related 101
  KO
K19730  autophagy-related protein 101
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04211  Longevity regulating pathway
Network
nt06128  Autophagy (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00155  Autophagy-vesicle nucleation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    60673 (ATG101)
   04136 Autophagy - other
    60673 (ATG101)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    60673 (ATG101)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    60673 (ATG101)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    60673 (ATG101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG101
Motif
Other DBs
NCBI-GeneID: 60673
NCBI-ProteinID: NP_001092143
OMIM: 615089
HGNC: 25679
Ensembl: ENSG00000123395
Vega: OTTHUMG00000169611
Pharos: Q9BSB4(Tbio)
UniProt: Q9BSB4 A0A024R128
Structure
PDB: 

Position
12q13.13
AA seq 218 aa AA seqDB search
MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFI
DFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWE
VWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDT
GLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtcgctcggaggtgctggaggtgtcggtggaggggcggcaggtggaggaggcc
atgctggctgtgctgcacacggtgcttctgcaccgcagcacaggcaagttccactacaag
aaggagggcacctactccattggcaccgtgggcacccaggatgttgactgtgacttcatc
gacttcacttatgtgcgtgtctcttctgaggaactggatcgtgccctgcgcaaggttgtt
ggggagttcaaggatgcactgcgcaactctggtggcgatgggctggggcagatgtccttg
gagttctaccagaagaagaagtctcgctggccattctcagacgagtgcatcccatgggaa
gtgtggacggtcaaggtgcatgtggtagccctggccacggagcaggagcggcagatctgc
cgggagaaggtgggtgagaaactctgcgagaagatcatcaacatcgtggaggtgatgaat
cggcatgagtacttgcccaagatgcccacacagtcggaggtggataacgtgtttgacaca
ggcttgcgggacgtgcagccctacctgtacaagatctccttccagatcactgatgccctg
ggcacctcagtcaccaccaccatgcgcaggctcatcaaagacacccttgccctctga

DBGET integrated database retrieval system