KEGG   Homo sapiens (human): 60676Help
Entry
60676             CDS       T01001                                 

Gene name
PAPPA2, PAPP-A2, PAPP-E, PAPPE, PLAC3
Definition
(RefSeq) pappalysin 2
  KO
K08647  pappalysin-2 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    60676 (PAPPA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     60676 (PAPPA2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M43: cytophagalysin family
   60676 (PAPPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_3 Peptidase_M43 Sushi Notch DUF4215 Laminin_G_2 Reprolysin_3 Laminin_G_1 DUF4953
Motif
Other DBs
NCBI-GeneID: 60676
NCBI-ProteinID: NP_064714
HGNC: 14615
Ensembl: ENSG00000116183
Vega: OTTHUMG00000035025
Pharos: Q9BXP8(Tbio)
UniProt: Q9BXP8
Position
1q25.2
AA seq 1791 aa AA seqDB search
MMCLKILRISLAILAGWALCSANSELGWTRKKSLVEREHLNQVLLEGERCWLGAKVRRPR
ASPQHHLFGVYPSRAGNYLRPYPVGEQEIHHTGRSKPDTEGNAVSLVPPDLTENPAGLRG
AVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESLGEAGIQKGSAMAATTTTAIFTTL
NEPKPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSHFQPWPKHSLKHRVKKSPPEESN
QNGGEGSYREAETFNSQVGLPILYFSGRRERLLLRPEVLAEIPREAFTVEAWVKPEGGQN
NPAIIAGVFDNCSHTVSDKGWALGIRSGKDKGKRDARFFFSLCTDRVKKATILISHSRYQ
PGTWTHVAATYDGRHMALYVDGTQVASSLDQSGPLNSPFMASCRSLLLGGDSSEDGHYFR
GHLGTLVFWSTALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEV
LQGFEPEPEILSPLQPPLCGQTVCDNVELISQYNGYWPLRGEKVIRYQVVNICDDEGLNP
IVSEEQIRLQHEALNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHVECNNMLNDFDDGDCCDPQVADVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNIYFASSVREDLAGAATWPWDKDAVTHLGGIVLSPA
YYGMPGHTDTMIHEVGHVLGLYHVFKGVSERESCNDPCKETVPSMETGDLCADTAPTPKS
ELCREPEPTSDTCGFTRFPGAPFTNYMSYTDDNCTDNFTPNQVARMHCYLDLVYQQWTES
RKPTPIPIPPMVIGQTNKSLTIHWLPPISGVVYDRASGSLCGACTEDGTFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPEVHLYHMNMTVPCPTEGCSLELLFQHP
VQADTLTLWVTSFFMESSQVLFDTEILLENKESVHLGPLDTFCDIPLTIKLHVDGKVSGV
KVYTFDERIEIDAALLTSQPHSPLCSGCRPVRYQVLRDPPFASGLPVVVTHSHRKFTDVE
VTPGQMYQYQVLAEAGGELGEASPPLNHIHGAPYCGDGKVSERLGEECDDGDLVSGDGCS
KVCELEEGFNCVGEPSLCYMYEGDGICEPFERKTSIVDCGIYTPKGYLDQWATRAYSSHE
DKKKCPVSLVTGEPHSLICTSYHPDLPNHRPLTGWFPCVASENETQDDRSEQPEGSLKKE
DEVWLKVCFNRPGEARAIFIFLTTDGLVPGEHQQPTVTLYLTDVRGSNHSLGTYGLSCQH
NPLIINVTHHQNVLFHHTTSVLLNFSSPRVGISAVALRTSSRIGLSAPSNCISEDEGQNH
QGQSCIHRPCGKQDSCPSLLLDHADVVNCTSIGPGLMKCAITCQRGFALQASSGQYIRPM
QKEILLTCSSGHWDQNVSCLPVDCGVPDPSLVNYANFSCSEGTKFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPEVYCKLECDAPPIILNANLLLPHCLQDNHDVGTICKYECKPGY
YVAESAEGKVRNKLLKIQCLEGGIWEQGSCIPVVCEPPPPVFEGMYECTNGFSLDSQCVL
NCNQEREKLPILCTKEGLWTQEFKLCENLQGECPPPPSELNSVEYKCEQGYGIGAVCSPL
CVIPPSDPVMLPENITADTLEHWMEPVKVQSIVCTGRRQWHPDPVLVHCIQSCEPFQADG
WCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcttaaagatcctaagaataagcctggcgattttggctgggtgggcactctgt
tctgccaactctgagctgggctggacacgcaagaaatccttggttgagagggaacacctg
aatcaggtgctgttggaaggagaacgttgttggctgggggccaaggttcgaagacccaga
gcttctccacagcatcacctctttggagtctaccccagcagggctgggaactacctaagg
ccctaccccgtgggggagcaagaaatccatcatacaggacgcagcaaaccagacactgaa
ggaaatgctgtgagccttgttcccccagacctgactgaaaatccagcaggactgaggggt
gcagttgaagagccggctgccccatgggtaggggatagtcctattgggcaatctgagctg
ctgggagatgatgacgcttatctcggcaatcaaagatccaaggagtctctaggtgaggcc
gggattcagaaaggctcagccatggctgccactactaccaccgccattttcacaaccctg
aacgaacccaaaccagagacccaaaggaggggctgggccaagtccaggcagcgtcgccaa
gtgtggaagaggcgggcggaagatgggcagggagactccggtatctcttcacatttccaa
ccttggcccaagcattcccttaaacacagggtcaaaaagagtccaccggaggaaagcaac
caaaatggtggagagggctcctaccgagaagcagagacctttaactcccaagtaggactg
cccatcttatacttctctgggaggcgggagcggctgctgctgcgtccagaagtgctggct
gagattccccgggaggcgttcacagtggaagcctgggttaaaccggagggaggacagaac
aacccagccatcatcgcaggtgtgtttgataactgctcccacactgtcagtgacaaaggc
tgggccctggggatccgctcagggaaggacaagggaaagcgggatgctcgcttcttcttc
tccctctgcaccgaccgcgtgaagaaagccaccatcttgattagccacagtcgctaccaa
ccaggcacatggacccatgtggcagccacttacgatggacggcacatggccctgtatgtg
gatggcactcaggtggctagcagtctagaccagtctggtcccctgaacagccccttcatg
gcatcttgccgctctttgctcctggggggagacagctctgaggatgggcactatttccgt
ggacacctgggcacactggttttctggtcgaccgccctgccacaaagccattttcagcac
agttctcagcattcaagtggggaggaggaagcgactgacttggtcctgacagcgagcttt
gagcctgtgaacacagagtgggttccctttagagatgagaagtacccacgacttgaggtt
ctccagggctttgagccagagcctgagattctgtcgcctttgcagcccccactctgtggg
caaacagtctgtgacaatgtggaattgatctcccagtacaatggatactggccccttcgg
ggagagaaggtgatacgctaccaggtggtgaacatctgtgatgatgagggcctaaacccc
attgtgagtgaggagcagattcgtctgcagcacgaggcactgaatgaggccttcagccgc
tacaacatcagctggcagctgagcgtccaccaggtccacaattccaccctgcgacaccgg
gttgtgcttgtgaactgtgagcccagcaagattggcaatgaccattgtgaccccgagtgt
gagcacccactcacaggctatgatgggggtgactgccgcctgcagggccgctgctactcc
tggaaccgcagggatgggctctgtcacgtggagtgtaacaacatgctgaacgactttgac
gacggagactgctgcgacccccaggtggctgatgtgcgcaagacctgctttgaccctgac
tcacccaagagggcatacatgagtgtgaaggagctgaaggaggccctgcagctgaacagt
actcacttcctcaacatctactttgccagctcagtgcgggaagaccttgcaggtgctgcc
acctggccttgggacaaggacgctgtcactcacctgggtggcattgtcctcagcccagca
tattatgggatgcctggccacaccgacaccatgatccatgaagtgggacatgttctggga
ctctaccatgtctttaaaggagtcagtgaaagagaatcctgcaatgacccctgcaaggag
acagtgccatccatggaaacgggagacctctgtgccgacaccgcccccactcccaagagt
gagctgtgccgggaaccagagcccactagtgacacctgtggcttcactcgcttcccaggg
gctccgttcaccaactacatgagctacacggatgataactgcactgacaacttcactcct
aaccaagtggcccgaatgcattgctatttggacctagtctatcagcagtggactgaaagc
agaaagcccacccccatccccattccacctatggtcatcggacagaccaacaagtccctc
actatccactggctgcctcctattagtggagttgtatatgacagggcctcaggcagcttg
tgtggcgcttgcactgaagatgggacctttcgtcagtatgtgcacacagcttcctcccgg
cgggtgtgtgactcctcaggttattggaccccagaggaggctgtggggcctcctgatgtg
gatcagccctgcgagccaagcttacaggcctggagccctgaggtccacctgtaccacatg
aacatgacggtcccctgccccacagaaggctgtagcttggagctgctcttccaacacccg
gtccaagccgacaccctcaccctgtgggtcacttccttcttcatggagtcctcgcaggtc
ctctttgacacagagatcttgctggaaaacaaggagtcagtgcacctgggccccttagac
actttctgtgacatcccactcaccatcaaactgcacgtggatgggaaggtgtcgggggtg
aaagtctacacctttgatgagaggatagagattgatgcagcactcctgacttctcagccc
cacagtcccttgtgctctggctgcaggcctgtgaggtaccaggttctccgcgatccccca
tttgccagtggtttgcccgtggtggtgacacattctcacaggaagttcacggacgtggag
gtcacacctggacagatgtatcagtaccaagttctagctgaagctggaggagaactggga
gaagcttcgcctcctctgaaccacattcatggagctccttattgtggagatgggaaggtg
tcagagagactgggagaagagtgtgatgatggagaccttgtgagcggagatggctgctcc
aaggtgtgtgagctggaggaaggtttcaactgtgtaggagagccaagcctttgctacatg
tatgagggagatggcatatgtgaaccttttgagagaaaaaccagcattgtagactgtggc
atctacactcccaaaggatacttggatcaatgggctacccgggcttactcctctcatgaa
gacaagaagaagtgtcctgtttccttggtaactggagaacctcattccctaatttgcaca
tcataccatccagatttacccaaccaccgtcccctaactggctggtttccctgtgttgcc
agtgaaaatgaaactcaggatgacaggagtgaacagccagaaggtagcctgaagaaagag
gatgaggtttggctcaaagtgtgtttcaatagaccaggagaggccagagcaatttttatt
tttttgacaactgatggcctagttcccggagagcatcagcagccgacagtgactctctac
ctgaccgatgtccgtggaagcaaccactctcttggaacctatggactgtcatgccagcat
aatccactgattatcaatgtgacccatcaccagaatgtccttttccaccataccacctca
gtgctgctgaatttctcatccccacgggtcggcatctcagctgtggctctaaggacatcc
tcccgcattggtctttcggctcccagtaactgcatctcagaggacgaggggcagaatcat
cagggacagagctgtatccatcggccctgtgggaagcaggacagctgtccgtcattgctg
cttgatcatgctgatgtggtgaactgtacctctataggcccaggtctcatgaagtgtgct
atcacttgtcaaaggggatttgcccttcaggccagcagtgggcagtacatcaggcccatg
cagaaggaaattctgctcacatgttcttctgggcactgggaccagaatgtgagctgcctt
cccgtggactgcggtgttcccgacccgtctttggtgaactatgcaaacttctcctgctca
gagggaaccaaatttctgaaacgctgctcaatctcttgtgtcccaccagccaagctgcaa
ggactgagcccatggctgacatgtcttgaagatggtctctggtctctccctgaagtctac
tgcaagttggagtgtgatgctccccctattattctgaatgccaacttgctcctgcctcac
tgcctccaggacaaccacgacgtgggcaccatctgcaaatatgaatgcaaaccagggtac
tatgtggcagaaagtgcagagggtaaagtcaggaacaagctcctgaagatacaatgcctg
gaaggtggaatctgggagcaaggcagctgcattcctgtggtgtgtgagccaccccctcct
gtgtttgaaggcatgtatgaatgtaccaatggcttcagcctggacagccagtgtgtgctc
aactgtaaccaggaacgtgaaaagcttcccatcctctgcactaaagagggcctgtggacc
caggagtttaagttgtgtgagaatctgcaaggagaatgcccaccacccccctcagagctg
aattctgtggagtacaaatgtgaacaaggatatgggattggtgcagtgtgttccccattg
tgtgtaatcccccccagtgaccccgtgatgctacctgagaatatcactgctgacactctg
gagcactggatggaacctgtcaaagtccagagcattgtgtgcactggccggcgtcaatgg
cacccagaccccgtcttagtccactgcatccagtcatgtgagcccttccaagcagatggt
tggtgtgacactatcaacaaccgagcctactgccactatgacgggggagactgctgctct
tccacactctcctccaagaaggtcattccatttgctgctgactgtgacctggatgagtgc
acctgccgggaccccaaggcagaagaaaatcagtaa

DBGET integrated database retrieval system