KEGG   Homo sapiens (human): 60680
Entry
60680             CDS       T01001                                 
Symbol
CELF5, BRUNOL-5, BRUNOL5, CELF-5
Name
(RefSeq) CUGBP Elav-like family member 5
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    60680 (CELF5)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    60680 (CELF5)
SSDB
Motif
Pfam: RRM_1 RRM_7 Peripla_BP_4
Other DBs
NCBI-GeneID: 60680
NCBI-ProteinID: NP_068757
OMIM: 612680
HGNC: 14058
Ensembl: ENSG00000161082
Pharos: Q8N6W0(Tdark)
UniProt: Q8N6W0
Structure
Position
19:3224661..3297076
AA seq 485 aa
MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKD
LKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQ
VKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVK
FSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLP
FSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLH
SPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAF
SGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMF
LPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKD
PGHPY
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcccgcctgacggagagcgaggcgcgccggcagcagcagcagctcctgcagccgcgg
ccctcgcccgtgggcagcagcgggcccgagccccccggggggcagcccgacggcatgaag
gacctggacgccatcaaactcttcgtgggccagatcccgcggcacctggacgagaaggac
ctcaagccgctcttcgagcagttcggccgcatctacgagctcacggtgctcaaagacccc
tacacggggatgcacaaaggctgtgccttcctcacctactgtgccagggattccgccatc
aaagctcagactgccctgcacgagcagaagaccttgcccggaatggcgcggccaatccag
gtgaagcctgcggacagtgaaagccgcggaggtagggaccggaagctgttcgtggggatg
ctgaacaagcagcagtcggaggaggacgtgctgcggctgttccagcccttcggggtcatt
gacgagtgcaccgtgctccgggggcctgacggcagcagcaaaggctgtgctttcgtgaag
ttctcctcccacacggaggcgcaggcggccatccacgccttgcatgggagccagaccatg
ccgggagcctcctccagcctggtggtcaagttcgccgacacggacaaggagcggacgctc
cggcgcatgcagcagatggtgggccagctgggcatcctgacgccgtccctcacattgccc
ttcagcccctacagtgcctacgcccaggctctcatgcaacagcagacaacagtcctgtcc
acctcgggcagctacctgagtcccggcgtggccttctcaccctgtcacatccagcagata
ggcgccgtcagcctcaacgggctgcctgccacacccatcgctcctgcctctgggctgcac
tcacccccgctgctgggcaccaccgctgtgcctggcctcgtggctcccatcaccaatggc
tttgcaggtgtcgtgccctttccaggtgggcaccctgccctggaaaccgtctatgccaat
ggccttgtgccctacccagctcagagcccgactgtggccgagacactgcatcctgccttc
tccggagtccagcagtacacagccatgtaccccaccgcggccatcacgcccatcgcgcac
agcgtcccccagccgccgcccctcctgcagcagcagcagcgagaaggtcccgagggctgt
aacctgtttatctaccacctcccccaggagtttggagacacggagctgacgcagatgttc
ctacccttcggcaatatcatttcctccaaggtgtttatggatcgagctaccaaccagagc
aagtgtttcggcttcgtgagctttgataacccggccagcgcccaggcagccatccaggcc
atgaacggcttccagatcggcatgaagaggctcaaagtccagctgaagcggcccaaagac
ccgggacacccctactga

DBGET integrated database retrieval system