KEGG   Homo sapiens (human): 60681Help
Entry
60681             CDS       T01001                                 

Gene name
FKBP10, BRKS1, FKBP65, OI11, OI6, PPIASE, hFKBP65
Definition
(RefSeq) FKBP prolyl isomerase 10
  KO
K09575  FK506-binding protein 9/10 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Disease
H00506  Osteogenesis imperfecta
H00514  Bruck syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    60681 (FKBP10)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     60681 (FKBP10)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    60681 (FKBP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 60681
NCBI-ProteinID: NP_068758
OMIM: 607063
HGNC: 18169
Ensembl: ENSG00000141756
Vega: OTTHUMG00000133497
Pharos: Q96AY3(Tbio)
UniProt: Q96AY3 A0A024R1W3 Q8NAG5 Q658U4
Position
17q21.2
AA seq 582 aa AA seqDB search
MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQ
MGDFVRYHYNGTFEDGKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVP
PHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYH
YNGTLLDGTSFDTSYSKGGTYDTYVGSGWLIKGMDQGLLGMCPGERRKIIIPPFLAYGEK
GYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCVRRAGAGDFMRYHYNGSLMDG
TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYGENGTGDKIPG
SAVLIFNVHVIDFHNPADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSH
DYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEV
ELVSREDGLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTFIKAQVSEGKGRLMPG
QDPEKTIGDMFQNQDRNQDGKITVDELKLKSDEDEERVHEEL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgttccccgcgggcccccccagccacagcctcctccggctccccctgctgcagttgctg
ctactggtggtgcaggccgtggggagggggctgggccgcgccagcccggccgggggcccc
ctggaagatgtggtcatcgagaggtaccacatccccagggcctgtccccgggaagtgcag
atgggggattttgtgcgctaccactacaacggcacttttgaagatggcaagaagtttgat
tcaagctatgatcgcaacaccttggtggccatcgtggtgggtgtggggcgcctcatcact
ggcatggaccgaggcctcatgggcatgtgtgtcaacgagcggcgacgcctcattgtgcct
ccccacctgggctatgggagcatcggcctggcggggctcattccaccggatgccaccctc
tacttcgatgtggttctgctggatgtgtggaacaaggaagacaccgtgcaggtgagcaca
ttgctgcgcccgccccactgcccccgcatggtccaggacggcgactttgtccgctaccac
tacaatggcaccctgctggacggcacctccttcgacaccagctacagtaagggcggcact
tatgacacctacgtcggctctggttggctgatcaagggcatggaccaggggctgctgggc
atgtgtcctggagagagaaggaagattatcatccctccattcctggcctatggcgagaaa
ggctatgggacagtgatccccccacaggcctcgctggtctttcacgtcctcctgattgac
gtgcacaacccgaaggacgctgtccagctagagacgctggagctcccccccggctgtgtc
cgcagagccggggccggggacttcatgcgctaccactacaatggctccttgatggacggc
accctcttcgattccagctactcccgcaaccacacctacaatacctatatcgggcagggt
tacatcatccccgggatggaccaggggctgcagggtgcctgcatgggggaacgccggaga
attaccatccccccgcacctcgcctatggggagaatggaactggagacaagatccctggc
tctgccgtgctaatcttcaacgtccatgtcattgacttccacaaccctgcggatgtggtg
gaaatcaggacactgtcccggccatctgagacctgcaatgagaccaccaagcttggggac
tttgttcgataccattacaactgttctttgctggacggcacccagctgttcacctcgcat
gactacggggccccccaggaggcgactctcggggccaacaaggtgatcgaaggcctggac
acgggcctgcagggcatgtgtgtgggagagaggcggcagctcatcgtgcccccgcacctg
gcccacggggagagtggagcccggggagtcccaggcagtgctgtgctgctgtttgaggtg
gagctggtgtcccgggaggatgggctgcccacaggctacctgtttgtgtggcacaaggac
cctcctgccaacctgtttgaagacatggacctcaacaaggatggcgaggtccctccggag
gagttctccaccttcatcaaggctcaagtgagtgagggcaaaggacgcctcatgcctggg
caggaccctgagaaaaccataggagacatgttccagaaccaggaccgcaaccaggacggc
aagatcacagtcgacgagctcaagctgaagtcagatgaggacgaggagcgggtccacgag
gagctctga

DBGET integrated database retrieval system