KEGG   Homo sapiens (human): 60682Help
Entry
60682             CDS       T01001                                 

Gene name
SMAP1, SMAP-1
Definition
(RefSeq) small ArfGAP 1
  KO
K12486  stromal membrane-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    60682 (SMAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    60682 (SMAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    60682 (SMAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    60682 (SMAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap EMC3_TMCO1 DUF3824 SR-25 DUF2027
Motif
Other DBs
NCBI-GeneID: 60682
NCBI-ProteinID: NP_001037770
OMIM: 611372
HGNC: 19651
Ensembl: ENSG00000112305
Vega: OTTHUMG00000014996
Pharos: Q8IYB5(Tbio)
UniProt: Q8IYB5
Structure
PDB: 

Position
6q13
AA seq 467 aa AA seqDB search
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKE
PEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLN
DDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQL
SKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVM
GQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWS
LSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcgctcctgtcgggagaaggctcagaagctgaacgagcagcaccagctcatc
ctatccaagcttctgagggaggaggacaacaagtactgcgccgactgcgaggccaaaggt
cctcgatgggcttcctggaatattggtgtgtttatttgcatcagatgtgctggaattcat
agaaatcttggggttcatatatccagggtcaaatcagtcaacctagaccaatggacagca
gaacagatacagtgcatgcaagatatgggaaatactaaagcaagactactctatgaagcc
aatcttccagagaactttcgaagaccacagacagatcaagcagtggaatttttcatcaga
gataaatatgaaaagaagaaatactacgataaaaatgccatagctattacaaatatttcc
tcctctgatgctcctcttcagcctttggtatcctctccttctctgcaagctgctgttgac
aaaaataaattggagaaagaaaaggaaaaaaaaaaggaagagaaaaagagagaaaaggag
ccagaaaagccggcaaaaccacttacagctgaaaagctgcagaagaaagatcagcaactg
gagcctaaaaaaagtaccagccctaaaaaagctgcggagcccactgtggatcttttagga
cttgatggccctgctgtggcaccagtgaccaacgggaacacaacggtgccacccctgaac
gatgatctggacatctttggaccgatgatttctaatcccttacctgcaactgtcatgccc
ccagctcaggggacaccctctgcaccagcagctgcaaccctgtctacagtaacatctggg
gatctagatttattcactgagcaaactacaaaatcagaagaagtggcaaagaaacaactt
tccaaagactccatcttatctctgtatggcacaggaaccattcaacagcaaagtactcct
ggtgtatttatgggacccacaaatataccatttacctcacaagcaccagctgcatttcag
ggctttccatcgatgggcgtgcctgtgcctgcagctcctggccttataggaaatgtgatg
ggacagagtccaagcatgatggtgggcatgcccatgcccaatgggtttatgggaaatgca
caaactggtgtgatgccacttcctcagaacgttgttggcccccaaggaggaatggtggga
caaatgggtgcaccccagagtaagtttggcctgccgcaagctcagcagccccagtggagc
ctctcacagatgaatcagcagatggctggcatgagtatcagtagtgcaacccctactgca
ggttttggccagccctccagcacaacagcaggatggtctggaagctcatcaggtcagact
ctcagcacacaactgtggaaatga

DBGET integrated database retrieval system