KEGG   Homo sapiens (human): 6092Help
Entry
6092              CDS       T01001                                 

Gene name
ROBO2, SAX3
Definition
(RefSeq) roundabout guidance receptor 2
  KO
K06754  roundabout, axon guidance receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H01037  Vesicoureteral reflux
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    6092 (ROBO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6092 (ROBO2)
   04515 Cell adhesion molecules [BR:hsa04515]
    6092 (ROBO2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6092 (ROBO2)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  ROBO family
   6092 (ROBO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set Ig_6 C2-set_2 Ig_5 Ig_4 Adeno_E3_CR1 Big_11
Motif
Other DBs
NCBI-GeneID: 6092
NCBI-ProteinID: NP_002933
OMIM: 602431
HGNC: 10250
Ensembl: ENSG00000185008
Vega: OTTHUMG00000158935
Pharos: Q9HCK4(Tbio)
UniProt: Q9HCK4
Structure
PDB: 

Position
3p12.3
AA seq 1378 aa AA seqDB search
MSLLMFTQLLLCGFLYVRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTP
TIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAV
SRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEER
ISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEE
AVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVG
KMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQ
PQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPII
LQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRI
SDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL
SWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINP
QGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDR
QPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQ
GMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNGIIQEYKIWCL
GNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVV
ITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRG
DGGLMSNGSRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQ
GDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQW
KSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQ
PLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASS
PAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPP
LGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSS
QRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSK
PSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL
NT seq 4137 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgctgatgtttacacaactactgctctgtggatttttatatgttcgggttgat
ggatcgcgtcttcgccaggaggactttcccccgcggattgtggagcatccttccgatgtc
atcgtctctaagggcgagcccacgactctgaactgcaaggcggagggccggccaacgccc
accattgagtggtacaaagatggggagcgagtggagactgacaaggacgatccccggtcc
cacaggatgcttctgcccagcggatccttattcttcttgcgcatcgtgcacgggcgcagg
agtaaacctgatgaaggaagctacgtttgtgttgcgaggaactatcttggtgaagcagtg
agtcgaaatgcgtctctggaagtggcattgttacgagatgacttccgacaaaaccccaca
gatgttgtagtggcagctggagagcctgcaatcctggagtgccagcctccccggggacac
ccagaacccaccatctactggaaaaaagacaaagttcgaattgatgacaaggaagaaaga
ataagtatccgtggtggaaaactgatgatctccaataccaggaaaagtgatgcagggatg
tatacttgtgttggtaccaatatggtgggagaaagggacagtgacccagcagagctgact
gtctttgaacgacccacatttctcaggaggccaattaaccaggtggtactggaggaagaa
gctgtagaatttcgttgtcaagtccaaggagatcctcaaccaactgtgaggtggaaaaag
gatgatgcagacttgccaagaggaaggtatgacatcaaagacgattacacactaagaatt
aaaaagaccatgagtacagatgaaggcacctatatgtgtattgctgagaatcgggttgga
aaaatggaagcctctgctacactcaccgtccgagctcccccacagtttgtggttcggcca
agagatcagattgttgctcaaggtcgaacagtgacatttccctgtgaaactaaaggaaac
ccacagccagctgttttttggcagaaagaaggcagccagaacctacttttcccaaaccaa
ccccagcagcccaacagtagatgctcagtgtcaccaactggagacctcacaatcaccaac
attcaacgttccgacgcgggttactacatctgccaggctttaactgtggcaggaagcatt
ttagcaaaagctcaactggaggttactgatgttttgacagatagacctccacctataatt
ctacaaggcccagccaaccaaacgctggcagtggatggtacagcgttactgaaatgtaaa
gccactggtgatcctcttcctgtaattagctggttaaaggagggatttacttttccgggt
agagatccaagagcaacaattcaagagcaaggcacactgcagattaagaatttacggatt
tctgatactggcacttatacttgtgtggctacaagttcaagtggagagacttcctggagt
gcagtgctggatgtgacagagtctggagcaacaatcagtaaaaactatgatttaagtgac
ctgccagggccaccatccaaaccgcaggtcactgatgttactaagaacagtgtcaccttg
tcctggcagccaggtacccctggaacccttccagcaagtgcatatatcattgaggctttc
agccaatcagtgagcaacagctggcagaccgtggcaaaccatgtaaagaccaccctctat
actgtaagaggactgcggcccaatacaatctacttattcatggtcagagcgatcaacccc
caaggtctcagtgacccaagtcccatgtcagatcctgtgcgcacacaagatatcagccca
ccagcacaaggagtggaccacaggcaagtgcagaaagagctaggagatgtccttgtccgt
cttcataatccagttgtgctgactcccaccacggttcaggtcacatggacggttgatcgc
caaccccagtttatccaaggctaccgagtgatgtatcgtcagacttcaggtctgcaggcg
acatcttcgtggcagaatttagatgccaaagtcccgactgaacgaagtgctgtcttagtc
aacctgaaaaagggggtgacttatgaaattaaagtacggccatattttaatgagttccaa
ggaatggatagtgaatctaaaacggttcgtactactgaagaagccccaagtgccccacca
cagtctgtcactgtactgacagttggaagctacaatagcacaagtattagtgtttcctgg
gatcctcctcctccagatcaccagaatggaattatccaagaatacaagatctggtgtcta
ggaaatgaaacgcgattccatatcaacaaaactgtggatgcagccattcggtccgtaata
attggtggattattcccaggtattcaataccgggtagaggttgcagctagtaccagtgca
ggggttggagtaaagagtgagccacagccaataataatcgggagacgcaatgaagttgtc
attactgaaaacaataacagcataactgagcaaatcactgatgtggtgaagcaaccagcc
tttatagctggtattggtggtgcctgctgggtaattctgatgggttttagcatatggttg
tattggcgaagaaagaagaggaagggactcagtaattatgctgttacgtttcaaagagga
gatggaggactaatgagcaatggaagccgtccaggtcttctcaatgctggtgatcccagc
tatccatggcttgctgattcttggccagccacgagcttgccagtaaataatagcaacagt
ggcccaaatgagattggaaattttggccgtggagatgtgctgccaccagttccaggccaa
ggggataaaacagcaacgatgctctcagatggagccatttatagtagcattgacttcact
accaaaaccagttacaacagttccagccaaataacacaggctaccccatatgccacgaca
cagatcttgcattccaacagcatacatgaattggctgtcgatctgcctgatccacaatgg
aaaagctcaattcagcaaaaaacagatctgatgggatttggttattctctacctgatcag
aacaaaggtaacaatggtgggaaaggtggaaaaaagaagaaaaataaaaactcttctaaa
ccacagaaaaacaatggatccacttgggccaatgtccctctacctccccccccagtccag
ccccttcctggcacggagctggaacactatgcagtggaacaacaagaaaatggctatgac
agtgatagctggtgcccaccattgccagtacaaacttacttacaccaaggtctggaagat
gaactggaagaagatgatgatagggtcccaacacctcctgttcgaggcgtggcttcttct
cctgctatctcctttggacagcagtccactgcaactcttactccatccccacgggaagag
atgcaacccatgctgcaggctcacctggatgagttgacaagagcctatcagtttgatata
gcaaaacaaacatggcacattcaaagcaataatcaacctccacagcctccagttccaccg
ttaggttatgtgtctggagccttgatttctgatttggaaacggatgttgcagatgatgat
gccgacgacgaagaggaagctttagaaatccccaggcccctgagagcactggaccagact
cctggatccagcatggacaatctagacagctctgtgacaggaaaagcctttacctcctct
caaagacctcgacctaccagcccattttctactgacagtaacaccagtgcagccctgagt
caaagtcagaggcctcggcccactaaaaaacacaagggagggcggatggaccaacaacca
gcattgcctcatcgaagggaaggaatgacagatgaggaggccttggtgccctatagcaag
cccagtttcccatctccaggtggccacagctcatcaggaacagcttcttctaagggatcc
actggacctaggaaaaccgaggtgttgagagcaggccaccagcgcaatgccagcgacctt
cttgacataggatatatgggctccaacagtcaaggacagtttacaggtgaattatag

DBGET integrated database retrieval system