KEGG   Homo sapiens (human): 6093Help
Entry
6093              CDS       T01001                                 

Gene name
ROCK1, P160ROCK, ROCK-I
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04921  Oxytocin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Drug target
Fasudil (DG00293): D01840 D03115 D07941
Netarsudil (DG02692): D11030 D11031
Ripasudil hydrochloride hydrate: D10463
Verosudil (DG01867): D10737 D10738
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    6093 (ROCK1)
   04071 Sphingolipid signaling pathway
    6093 (ROCK1)
   04024 cAMP signaling pathway
    6093 (ROCK1)
   04022 cGMP - PKG signaling pathway
    6093 (ROCK1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    6093 (ROCK1)
   04530 Tight junction
    6093 (ROCK1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    6093 (ROCK1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    6093 (ROCK1)
   04670 Leukocyte transendothelial migration
    6093 (ROCK1)
   04062 Chemokine signaling pathway
    6093 (ROCK1)
  Endocrine system
   04921 Oxytocin signaling pathway
    6093 (ROCK1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    6093 (ROCK1)
  Development
   04360 Axon guidance
    6093 (ROCK1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    6093 (ROCK1)
   05206 MicroRNAs in cancer
    6093 (ROCK1)
   05205 Proteoglycans in cancer
    6093 (ROCK1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    6093 (ROCK1)
   05132 Salmonella infection
    6093 (ROCK1)
   05131 Shigellosis
    6093 (ROCK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6093 (ROCK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   6093 (ROCK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    6093 (ROCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH HR1 Pkinase_C
Motif
Other DBs
NCBI-GeneID: 6093
NCBI-ProteinID: NP_005397
OMIM: 601702
HGNC: 10251
Ensembl: ENSG00000067900
Vega: OTTHUMG00000131723
Pharos: Q13464(Tclin)
UniProt: Q13464
Structure
PDB: 

Position
18q11.1
AA seq 1354 aa AA seqDB search
MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcgatttgaaaaaatggacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtatatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaatcagagatttacgaatgaaagctgaagattatgaagtagtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatccaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgataaagagatctgattctgctttt
ttctgggaagaaagggacatcatggcttttgccaacagtccttgggttgttcagcttttt
tatgcattccaagatgatcgttatctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgcctgaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcacagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggcatggtacgatgtgatacagcggttggaacacctgattat
atttcccctgaagtattaaaatcccaaggtggtgatggttattatggaagagaatgtgac
tggtggtcggttggggtatttttatacgaaatgcttgtaggtgatacacctttttatgca
gattctttggttggaacttacagtaaaattatgaaccataaaaattcacttacctttcct
gatgataatgacatatcaaaagaagcaaaaaaccttatttgtgccttccttactgacagg
gaagtgaggttagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gaccagtgggcttgggaaacgctccgagacactgtagcaccagttgtacccgatttaagt
agtgacattgatactagtaattttgatgacttggaagaagataaaggagaggaagaaaca
ttccctattcctaaagctttcgttggcaatcaactaccttttgtaggatttacatattat
agcaatcgtagatacttatcttcagcaaatcctaatgataacagaactagctccaatgca
gataaaagcttgcaggaaagtttgcaaaaaacaatctataagctggaagaacagctgcat
aatgaaatgcagttaaaagatgaaatggagcagaagtgcagaacctcaaacataaaacta
gacaagataatgaaagaattggatgaagagggaaatcaaagaagaaatctagaatctaca
gtgtctcagattgagaaggagaaaatgttgctacagcatagaattaatgagtaccaaaga
aaagctgaacaggaaaatgagaagagaagaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtcagtcagaattcacagcttgctaatgagaagctg
tcccagttacaaaagcagctagaagaagccaatgacttacttaggacagaatcggacaca
gctgtaagattgaggaagagtcacacagagatgagcaagtcaattagtcagttagagtcc
ctgaacagagagttgcaagagagaaatcgaattttagagaattctaagtcacaaacagac
aaagattattaccagctgcaagctatattagaagctgaacgaagagacagaggtcatgat
tctgagatgattggagaccttcaagctcgaattacatctttacaagaggaggtgaagcat
ctcaaacataatctcgaaaaagtggaaggagaaagaaaagaggctcaagacatgcttaat
cactcagaaaaggaaaagaataatttagagatagatttaaactacaaacttaaatcatta
caacaacggttagaacaagaggtaaatgaacacaaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgtggcaatgtgtgagatggaaaaaaagctg
aaagaagaaagagaagctcgagagaaggctgaaaatcgggttgttcagattgagaaacag
tgttccatgctagacgttgatctgaagcaatctcagcagaaactagaacatttgactgga
aataaagaaaggatggaggatgaagttaagaatctaaccctgcaactggagcaggaatca
aataagcggctgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtttagaaaagcagatgaaacaggaaataaatactttattggaagcaaagagatta
ttagaatttgagttagctcagcttacgaaacagtatagaggaaatgaaggacagatgcgg
gagctacaagatcagcttgaagctgagcaatatttctcgacactttataaaacccaggta
aaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgaaaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggcgcgaggccttctggaagaacagtattttgaattgacgcaagaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcacactgttagtcgg
cttgaagaagcaaacagcatgctaaccaaagatattgaaatattaagaagagagaatgaa
gagctaacagagaaaatgaagaaggcagaggaagaatataaactggagaaggaggaggag
atcagtaatcttaaggctgcctttgaaaagaatatcaacactgaacgaacccttaaaaca
caggctgttaacaaattggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaagatttgagaaagaaagaaaaggaaaatcgaaagctgcaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcagaaggaactgaat
gacatgcaagcgcaattggtagaagaatgtgcacataggaatgagcttcagatgcagttg
gccagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctctcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggtaacctcccagagtcaaga
attgaaggttggctttcagtaccaaatagaggaaatatcaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttgttctataatgacgaacaagataaggag
caatccaatccatctatggtattggacatagataaactgtttcacgttagacctgtaacc
caaggagatgtgtatagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatgtagagatggaaccagtacaacaagctgaaaaa
actaatttccaaaatcacaaaggccatgagtttattcctacactctaccactttcctgcc
aattgtgatgcctgtgccaaacctctctggcatgtttttaagccaccccctgccctagag
tgtcgaagatgccatgttaagtgccacagagatcacttagataagaaagaggacttaatt
tgtccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaaaatccctaagaatcca
ccatctggttttgttcgtgcttcccctcgaacgctttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system