KEGG   Homo sapiens (human): 6095Help
Entry
6095              CDS       T01001                                 

Gene name
RORA, NR1F1, ROR1, ROR2, ROR3, RZR-ALPHA, RZRA
Definition
(RefSeq) RAR related orphan receptor A
  KO
K08532  RAR-related orphan receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04710  Circadian rhythm
hsa05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6095 (RORA)
  09159 Environmental adaptation
   04710 Circadian rhythm
    6095 (RORA)
 09160 Human Diseases
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    6095 (RORA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6095 (RORA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6095 (RORA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    6095 (RORA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6095 (RORA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 6095
NCBI-ProteinID: NP_599023
OMIM: 600825
HGNC: 10258
Ensembl: ENSG00000069667
Vega: OTTHUMG00000132769
Pharos: P35398(Tchem)
UniProt: P35398
Structure
PDB: 

Position
15q22.2
AA seq 523 aa AA seqDB search
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggagtcagctccggcagcccccgaccccgccgccagcgagccaggcagcagcggcgcg
gacgcggccgccggctccagggagaccccgctgaaccaggaatccgcccgcaagagcgag
ccgcctgccccggtgcgcagacagagctattccagcaccagcagaggtatctcagtaacg
aagaagacacatacatctcaaattgaaattattccatgcaagatctgtggagacaaatca
tcaggaatccattatggtgtcattacatgtgaaggctgcaagggctttttcaggagaagt
cagcaaagcaatgccacctactcctgtcctcgtcagaagaactgtttgattgatcgaacc
agtagaaaccgctgccaacactgtcgattacagaaatgccttgccgtagggatgtctcga
gatgctgtaaaatttggccgaatgtcaaaaaagcagagagacagcttgtatgcagaagta
cagaaacaccggatgcagcagcagcagcgcgaccaccagcagcagcctggagaggctgag
ccgctgacgcccacctacaacatctcggccaacgggctgacggaacttcacgacgacctc
agtaactacattgacgggcacacccctgaggggagtaaggcagactccgccgtcagcagc
ttctacctggacatacagccttccccagaccagtcaggtcttgatatcaatggaatcaaa
ccagaaccaatatgtgactacacaccagcatcaggcttctttccctactgttcgttcacc
aacggcgagacttccccaactgtgtccatggcagaattagaacaccttgcacagaatata
tctaaatcgcatctggaaacctgccaatacttgagagaagagctccagcagataacgtgg
cagacctttttacaggaagaaattgagaactatcaaaacaagcagcgggaggtgatgtgg
caattgtgtgccatcaaaattacagaagctatacagtatgtggtggagtttgccaaacgc
attgatggatttatggaactgtgtcaaaatgatcaaattgtgcttctaaaagcaggttct
ctagaggtggtgtttatcagaatgtgccgtgcctttgactctcagaacaacaccgtgtac
tttgatgggaagtatgccagccccgacgtcttcaaatccttaggttgtgaagactttatt
agctttgtgtttgaatttggaaagagtttatgttctatgcacctgactgaagatgaaatt
gcattattttctgcatttgtactgatgtcagcagatcgctcatggctgcaagaaaaggta
aaaattgaaaaactgcaacagaaaattcagctagctcttcaacacgtcctacagaagaat
caccgagaagatggaatactaacaaagttaatatgcaaggtgtctacattaagagcctta
tgtggacgacatacagaaaagctaatggcatttaaagcaatatacccagacattgtgcga
cttcattttcctccattatacaaggagttgttcacttcagaatttgagccagcaatgcaa
attgatgggtaa

DBGET integrated database retrieval system