KEGG   Homo sapiens (human): 6096Help
Entry
6096              CDS       T01001                                 

Gene name
RORB, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1
Definition
(RefSeq) RAR related orphan receptor B
  KO
K08533  RAR-related orphan receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    6096 (RORB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6096 (RORB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6096 (RORB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    6096 (RORB)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6096 (RORB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 6096
NCBI-ProteinID: NP_001351952
OMIM: 601972
HGNC: 10259
Ensembl: ENSG00000198963
Vega: OTTHUMG00000020026
Position
9q21.13
AA seq 470 aa AA seqDB search
MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgagaaccagctcaaaactaaagctgacgccactgcacaaattgaagtgatacca
tgcaaaatttgtggcgataagtcctctgggatccactacggagtcatcacatgtgaaggc
tgcaagggattctttaggaggagccagcagaacaatgcttcttattcctgcccaaggcag
agaaactgtttaattgacagaacgaacagaaaccgttgccaacactgccgactgcagaag
tgtcttgccctaggaatgtcaagagatgctgtgaagtttgggaggatgtccaagaagcaa
agggacagcctgtatgctgaggtgcagaagcaccagcagcggctgcaggaacagcggcag
cagcagagtggggaggcagaagcccttgccagggtgtacagcagcagcattagcaacggc
ctgagcaacctgaacaacgagaccagcggcacttatgccaacgggcacgtcattgacctg
cccaagtctgagggttattacaacgtcgattccggtcagccgtcccctgatcagtcagga
cttgacatgactggaatcaaacagataaagcaagaacctatctatgacctcacatccgta
cccaacttgtttacctatagctctttcaacaatgggcagttagcaccagggataaccatg
actgaaatcgaccgaattgcacagaacatcattaagtcccatttggagacatgtcaatac
accatggaagagctgcaccagctggcgtggcagacccacacctatgaagaaattaaagca
tatcaaagcaagtccagggaagcactgtggcaacaatgtgccatccagatcactcacgcc
atccaatacgtggtggagtttgcaaagcggataacaggcttcatggagctctgtcaaaat
gatcaaattctacttctgaagtcaggttgcttggaagtggttttagtgagaatgtgccgt
gccttcaacccattaaacaacactgttctgtttgaaggaaaatatggaggaatgcaaatg
ttcaaagccttaggttctgatgacctagtgaatgaagcatttgactttgcaaagaatttg
tgttccttgcagctgaccgaggaggagatcgctttgttctcatctgctgttctgatatct
ccagaccgagcctggcttatagaaccaaggaaagtccagaagcttcaggaaaaaatttat
tttgcacttcaacatgtgattcagaagaatcacctggatgatgagaccttggcaaagtta
atagccaagataccaaccatcacggcagtttgcaacttgcacggggagaagctgcaggta
tttaagcaatctcatccagagatagtgaatacactgtttcctccgttatacaaggagctc
tttaatcctgactgtgccaccggctgcaaatga

DBGET integrated database retrieval system