KEGG   Homo sapiens (human): 6102
Entry
6102              CDS       T01001                                 

Gene name
RP2, DELXp11.3, NM23-H10, NME10, TBCCD2, XRP2
Definition
(RefSeq) RP2 activator of ARL3 GTPase
  KO
K18272  protein XRP2
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6102 (RP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6102 (RP2)
SSDB
Motif
Pfam: TBCC CAP_C NDK
Other DBs
NCBI-GeneID: 6102
NCBI-ProteinID: NP_008846
OMIM: 300757
HGNC: 10274
Ensembl: ENSG00000102218
Vega: OTTHUMG00000021430
Pharos: O75695(Tbio)
UniProt: O75695 A0A1B2JLU2
Structure
PDB: 
3BH7 3BH6 2BX6

Position
Xp11.3
AA seq 350 aa
MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQ
QFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVR
DCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPV
SGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVL
FAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIAL
EFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgggctgcttcttctccaagagacggaaggctgacaaggagtcgcggcccgagaacgag
gaggagcggccaaagcagtacagctgggatcagcgcgagaaggttgatccaaaagactac
atgttcagtggactgaaggatgaaacagtaggtcgcttacctgggacggtagcaggacaa
cagtttctcattcaagactgtgagaactgtaacatctatatttttgatcactctgctaca
gttaccattgatgactgtactaactgcataatttttctgggacccgtgaaaggcagcgtg
tttttccggaattgcagagattgcaagtgcacattagcctgccaacaatttcgtgtgcga
gattgtagaaagctggaagtctttttgtgttgtgccactcaacccatcattgagtcttcc
tcaaatatcaaatttggatgttttcaatggtactatcctgaattagctttccagttcaaa
gatgcagggctaagtatcttcaacaatacatggagtaacattcatgactttacacctgtg
tcaggagaactcaactggagccttcttccagaagatgctgtggttcaggactatgttcct
atacctactaccgaagagctcaaagctgttcgtgtttccacagaagccaatagaagcatt
gttccaatatcccggggtcagagacagaagagcagcgatgaatcatgcttagtggtatta
tttgctggtgattacactattgcaaatgccagaaaactaattgatgagatggttggtaaa
ggctttttcctagttcagacaaaggaagtgtccatgaaagctgaggatgctcaaagggtt
tttcgggaaaaagcacctgacttccttcctcttctgaacaaaggtcctgttattgccttg
gagtttaatggggatggtgctgtagaagtatgtcaacttattgtaaacgagatattcaat
gggaccaagatgtttgtatctgaaagcaaggagacggcatctggagatgtagacagcttc
tacaactttgctgatatacagatgggaatatga

DBGET integrated database retrieval system