KEGG   Homo sapiens (human): 611Help
Entry
611               CDS       T01001                                 

Gene name
OPN1SW, BCP, BOP, CBT
Definition
(RefSeq) opsin 1, short wave sensitive
  KO
K04252  short wavelength-sensitive opsin
Organism
hsa  Homo sapiens (human)
Disease
H00976  Colorblindness
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    611 (OPN1SW)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Vision
   Opsin
    611 (OPN1SW)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7tm_4 WBP-1
Motif
Other DBs
NCBI-GeneID: 611
NCBI-ProteinID: NP_001699
OMIM: 613522
HGNC: 1012
Ensembl: ENSG00000128617
Vega: OTTHUMG00000158311
Pharos: P03999(Tbio)
UniProt: P03999 Q0PJU0
Position
7q32.1
AA seq 348 aa AA seqDB search
MRKMSEEEFYLFKNISSVGPWDGPQYHIAPVWAFYLQAAFMGTVFLIGFPLNAMVLVATL
RYKKLRQPLNYILVNVSFGGFLLCIFSVFPVFVASCNGYFVFGRHVCALEGFLGTVAGLV
TGWSLAFLAFERYIVICKPFGNFRFSSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGL
QCSCGPDWYTVGTKYRSESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATT
QKAEREVSRMVVVMVGSFCVCYVPYAAFAMYMVNNRNHGLDLRLVTIPSFFSKSACIYNP
IIYCFMNKQFQACIMKMVCGKAMTDESDTCSSQKTEVSTVSSTQVGPN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatgtcggaggaagagttttatctgttcaaaaatatctcttcagtggggccg
tgggatgggcctcagtaccacattgcccctgtctgggccttctacctccaggcagctttc
atgggcactgtcttccttatagggttcccactcaatgccatggtgctggtggccacactg
cgctacaaaaagttgcggcagcccctcaactacattctggtcaacgtgtccttcggaggc
ttcctcctctgcatcttctctgtcttccctgtcttcgtcgccagctgtaacggatacttc
gtcttcggtcgccatgtttgtgctttggagggcttcctgggcactgtagcaggtctggtt
acaggatggtcactggccttcctggcctttgagcgctacattgtcatctgtaagcccttc
ggcaacttccgcttcagctccaagcatgcactgacggtggtcctggctacctggaccatt
ggtattggcgtctccatcccacccttctttggctggagccggttcatccctgagggcctg
cagtgttcctgtggccctgactggtacaccgtgggcaccaaataccgcagcgagtcctat
acgtggttcctcttcatcttctgcttcattgtgcctctctccctcatctgcttctcctac
actcagctgctgagggccctgaaagctgttgcagctcagcagcaggagtcagctacgacc
cagaaggctgaacgggaggtgagccgcatggtggttgtgatggtaggatccttctgtgtc
tgctacgtgccctacgcggccttcgccatgtacatggtcaacaaccgtaaccatgggctg
gacttacggcttgtcaccattccttcattcttctccaagagtgcttgcatctacaatccc
atcatctactgcttcatgaataagcagttccaagcttgcatcatgaagatggtgtgtggg
aaggccatgacagatgaatccgacacatgcagctcccagaaaacagaagtttctactgtc
tcgtctacccaagttggccccaactga

DBGET integrated database retrieval system