KEGG   Homo sapiens (human): 6117Help
Entry
6117              CDS       T01001                                 

Gene name
RPA1, HSSB, MST075, REPA1, RF-A, RP-A, RPA70
Definition
(RefSeq) replication protein A1
  KO
K07466  replication factor A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    6117 (RPA1)
   03420 Nucleotide excision repair
    6117 (RPA1)
   03430 Mismatch repair
    6117 (RPA1)
   03440 Homologous recombination
    6117 (RPA1)
   03460 Fanconi anemia pathway
    6117 (RPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6117 (RPA1)
   03032 DNA replication proteins [BR:hsa03032]
    6117 (RPA1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6117 (RPA1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys4 zinc finger factors
    6117 (RPA1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6117 (RPA1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6117 (RPA1)
   MMR (mismatch excision repair)
     6117 (RPA1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6117 (RPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon IBR DUF223
Motif
Other DBs
NCBI-GeneID: 6117
NCBI-ProteinID: NP_002936
OMIM: 179835
HGNC: 10289
Ensembl: ENSG00000132383
Vega: OTTHUMG00000090579
Pharos: P27694(Tchem)
UniProt: P27694
Structure
PDB: 

Position
17p13.3
AA seq 616 aa AA seqDB search
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLAT
QLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
GLGQPQVAPPAPAASPAASSRPQPQNGSSGMGSTVSKAYGASKTFGKAAGPSLSHTSGGT
QSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNE
QVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQF
DFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATL
WGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ
ALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQA
CPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAIL
GQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYR
EYGRRLVMSIRRSALM
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggtcggccaactgagcgagggggccattgcggccatcatgcagaagggggatacaaac
ataaagcccatcctccaagtcatcaacatccgtcccattactacggggaatagtccgccg
cgttatcgactgctcatgagtgatggattgaacactctatcctctttcatgttggcgaca
cagttgaaccctctcgtggaggaagaacaattgtccagcaactgtgtatgccagattcac
agatttattgtgaacactctgaaagacggaaggagagtagttatcttgatggaattagaa
gttttgaagtcagctgaagcagttggagtgaagattggcaatccagtgccctataatgaa
ggactcgggcagccgcaagtagctcctccagcgccagcagccagcccagcagcaagcagc
aggccccagccgcagaatggaagctcgggaatgggttctactgtttctaaggcttatggt
gcttcaaagacatttggaaaagctgcaggtcccagcctgtcacacacttctgggggaaca
cagtccaaagtggtgcccattgccagcctcactccttaccagtccaagtggaccatttgt
gctcgtgttaccaacaaaagtcagatccgtacctggagcaactcccgaggggaagggaag
cttttctccctagaactggttgacgaaagtggtgaaatccgagctacagctttcaatgag
caagtggacaagttctttcctcttattgaagtgaacaaggtgtattatttctcgaaaggc
accctgaagattgctaacaagcagttcacagctgttaaaaatgactacgagatgaccttc
aataacgagacttccgtcatgccctgtgaggacgaccatcatttacctacggttcagttt
gatttcacggggattgatgacctcgagaacaagtcgaaagactcacttgtagacatcatc
gggatctgcaagagctatgaagacgccactaaaatcacagtgaggtctaacaacagagaa
gttgccaagaggaatatctacttgatggacacatccgggaaggtggtgactgctacactg
tggggggaagatgctgataaatttgatggttctagacagcccgtgttggctatcaaagga
gcccgagtctctgatttcggtggacggagcctctccgtgctgtcttcaagcactatcatt
gcgaatcctgacatcccagaggcctataagcttcgtggatggtttgacgcagaaggacaa
gccttagatggtgtttccatctctgatctaaagagcggcggagtcggagggagtaacacc
aactggaaaaccttgtatgaggtcaaatccgagaacctgggccaaggcgacaagccggac
tactttagttctgtggccacagtggtgtatcttcgcaaagagaactgcatgtaccaagcc
tgcccgactcaggactgcaataagaaagtgattgatcaacagaatggattgtaccgctgt
gagaagtgcgacaccgaatttcccaatttcaagtaccgcatgatcctgtcagtaaatatt
gcagattttcaagagaatcagtgggtgacttgtttccaggagtctgctgaagctatcctt
ggacaaaatgctgcttatcttggggaattaaaagacaagaatgaacaggcatttgaagaa
gttttccagaatgccaacttccgatctttcatattcagagtcagggtcaaagtggagacc
tacaacgacgagtctcgaattaaggccactgtgatggacgtgaagcccgtggactacaga
gagtatggccgaaggctggtcatgagcatcaggagaagtgcattgatgtga

DBGET integrated database retrieval system