KEGG   Homo sapiens (human): 6118
Entry
6118              CDS       T01001                                 
Symbol
RPA2, REPA2, RP-A_p32, RP-A_p34, RPA32
Name
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Network
nt06502  Nucleotide excision repair
nt06503  Mismatch repair
nt06506  Double-strand break repair
nt06508  Interstrand crosslink repair
  Element
N01431  Core NER reaction
N01432  Mismatch repair
N01446  DNA end resection and RPA loading
N01451  ATR signaling
N01452  Homologous recombination
N01466  Homologous recombination in ICLR
N01471  Origin unwinding and elongation
N01539  RAD51 -dsDNA destabilization
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    6118 (RPA2)
   03420 Nucleotide excision repair
    6118 (RPA2)
   03430 Mismatch repair
    6118 (RPA2)
   03440 Homologous recombination
    6118 (RPA2)
   03460 Fanconi anemia pathway
    6118 (RPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    6118 (RPA2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6118 (RPA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6118 (RPA2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6118 (RPA2)
   MMR (mismatch excision repair)
     6118 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6118 (RPA2)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon TFA2_Winged_2
Other DBs
NCBI-GeneID: 6118
NCBI-ProteinID: NP_002937
OMIM: 179836
HGNC: 10290
Ensembl: ENSG00000117748
Pharos: P15927(Tbio)
UniProt: P15927
Structure
Position
1:complement(27891524..27914797)
AA seq 270 aa
MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLV
DEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGR
APISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVS
SIKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtggaacagtggattcgaaagctatggcagctcctcatacgggggagccggcggctac
acgcagtccccggggggctttggatcgcccgcaccttctcaagccgaaaagaaatcaaga
gcccgagcccagcacattgtgccctgtactatatctcagctgctttctgccactttggtt
gatgaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatcatc
agacatgcagagaaggctccaaccaacattgtttacaaaatagatgacatgacagctgca
cccatggacgttcgccagtgggttgacacagatgacaccagcagtgaaaacactgtggtt
cctccagaaacatatgtgaaagtggcaggccacctgagatcttttcagaacaaaaagagc
ctggtagcctttaagatcatgcccctggaggatatgaatgagttcaccacacatattctg
gaagtgatcaatgcacacatggtactaagcaaagccaacagccagccctcagcagggaga
gcacctatcagcaatccaggaatgagtgaagcagggaactttggtgggaatagcttcatg
ccagcaaatggcctcactgtggcccaaaaccaggtgttgaatttgattaaggcttgtcca
agacctgaagggttgaactttcaggatctcaagaaccagctgaaacacatgtctgtatcc
tcaatcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtggat
gatgaccattttaaatccacagatgcagaataa

DBGET integrated database retrieval system