KEGG   Homo sapiens (human): 6119
Entry
6119              CDS       T01001                                 

Symbol
RPA3, REPA3, RP-A_p14
Name
(RefSeq) replication protein A3
  KO
K10740  replication factor A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    6119 (RPA3)
   03420 Nucleotide excision repair
    6119 (RPA3)
   03430 Mismatch repair
    6119 (RPA3)
   03440 Homologous recombination
    6119 (RPA3)
   03460 Fanconi anemia pathway
    6119 (RPA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    6119 (RPA3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    6119 (RPA3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    6119 (RPA3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     6119 (RPA3)
   MMR (mismatch excision repair)
     6119 (RPA3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     6119 (RPA3)
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-GeneID: 6119
NCBI-ProteinID: NP_002938
OMIM: 179837
HGNC: 10291
Ensembl: ENSG00000106399
Vega: OTTHUMG00000023748
Pharos: P35244(Tbio)
UniProt: P35244 A4D105
Structure
PDB: 

Position
7p21.3
AA seq 121 aa
MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLD
EEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQH
D
NT seq 366 nt   +upstreamnt  +downstreamnt
atggtggacatgatggacttgcccaggtcgcgcatcaacgccggcatgctagctcaattc
atcgacaagcctgtctgcttcgtagggaggctggaaaagattcatcccaccggaaaaatg
tttattctttcagatggagaaggaaaaaatggaaccatcgagttgatggaaccccttgat
gaagaaatctctggaattgtggaagtggttggaagagtaaccgccaaggccaccatcttg
tgtacatcttatgtccagtttaaagaagatagccatccttttgatcttggactttacaat
gaagctgtgaaaattatccatgacttccctcagttttatcctttagggattgtgcaacat
gattga

DBGET integrated database retrieval system