KEGG   Homo sapiens (human): 6123
Entry
6123              CDS       T01001                                 

Gene name
RPL3L
Definition
(RefSeq) ribosomal protein L3 like
  KO
K02925  large subunit ribosomal protein L3e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6123 (RPL3L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6123 (RPL3L)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6123 (RPL3L)
SSDB
Motif
Pfam: Ribosomal_L3 DUF1948
Other DBs
NCBI-GeneID: 6123
NCBI-ProteinID: NP_005052
OMIM: 617416
HGNC: 10351
Ensembl: ENSG00000140986
Vega: OTTHUMG00000128685
Pharos: Q92901(Tdark)
UniProt: Q92901
Position
16p13.3
AA seq 407 aa
MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREV
HRPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYK
DWHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAHI
MEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVK
NNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV
ENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQKKHLEKETPETSGDL
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtcccaccggaagttttccgcccctcggcacggacacctgggcttcctgccccataag
aggagccaccggcaccggggcaaggtgaagacgtggccgcgggatgaccccagccagccc
gtgcacctcacggccttcctgggctacaaggcgggcatgacccacaccctgcgggaggtg
caccggccggggctcaaaatttccaaacgggaggaggtggaggcggtgacaattgtagaa
acgccgcccctagtggtggtgggcgtggtgggctacgtggccacccctcgaggtctccgg
agcttcaagaccatctttgcagaacacctcagtgatgagtgccggcgccgattctacaag
gactggcacaagagcaagaagaaagccttcaccaaggcctgcaagaggtggcgggacaca
gacgggaaaaagcagctacagaaggacttcgccgccatgaagaagtactgcaaggtcatt
cgggtcattgtccacactcagatgaaactgctgcccttccggcagaagaaggcccacatc
atggagatccagctgaacggtggcacggtggccgagaaggtggcctgggcccaggcccgg
ctggagaagcaggtgcccgtgcacagcgtgttcagccagagtgaggtcattgatgtcatt
gctgtcaccaagggtcgaggcgtcaaaggggtcacaagccgctggcataccaagaagctg
ccgcggaagacccataagggcctgcgcaaggtggcctgcattggcgcctggcaccccgcc
cgcgtgggctgctccattgctcgggccgggcagaagggctatcaccaccgcacggagctc
aacaagaagatcttccgcatcggcaggggcccgcacatggaggacgggaagctggtgaag
aacaatgcatccaccagctacgacgtgactgccaagtccatcacaccgctgggtggcttc
ccccactacggggaagtgaacaacgacttcgtcatgctgaagggttgtattgctggtacc
aagaagcgggtcattacgctgagaaagtccctcctggtgcatcacagtcgccaagccgtg
gagaatattgagctcaagttcattgacaccacctccaagttcggccatggccgcttccag
acagcccaagagaagagggccttcatgggcccccaaaagaagcatctggagaaggaaacg
ccggagacctcgggagacttgtag

DBGET integrated database retrieval system