KEGG   Homo sapiens (human): 613209
Entry
613209            CDS       T01001                                 

Gene name
DEFB135, DEFB136
Definition
(RefSeq) defensin beta 135
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Defensin_beta_2 Defensin_big
Other DBs
NCBI-GeneID: 613209
NCBI-ProteinID: NP_001028189
HGNC: 32400
Ensembl: ENSG00000205883
Vega: OTTHUMG00000158719
Pharos: Q30KP9(Tdark)
UniProt: Q30KP9
Position
8p23.1
AA seq 77 aa
MATRSVLLALVVLNLLFYVPPGRSGPNVYIQKIFASCWRLQGTCRPKCLKNEQYRILCDT
IHLCCVNPKYLPILTGK
NT seq 234 nt   +upstreamnt  +downstreamnt
atggccacaaggagcgtcctcttggccctcgtggtccttaacttactcttctatgttcca
ccaggtagaagtggacccaatgtctacatacaaaaaatctttgcttcatgttggcgactg
caaggtacttgccggccaaaatgtctaaaaaacgaacaatatcgtattttgtgtgatact
atacatttgtgctgtgtaaacccaaaatatttacctatactgactgggaaatag

DBGET integrated database retrieval system